BIOSERVICES: access to biological web services programmatically

https://badge.fury.io/py/bioservices.svg https://github.com/cokelaer/bioservices/actions/workflows/ci.yml/badge.svg Documentation Status https://static.pepy.tech/personalized-badge/bioservices?period=month&units=international_system&left_color=black&right_color=orange&left_text=Downloads https://raw.githubusercontent.com/cokelaer/bioservices/main/doc/_static/bioservices2_logo_256.png
Python_version_available

BioServices is tested for Python 3.7, 3.8, 3.9, 3.10

Contributions

Please join https://github.com/cokelaer/bioservices

Issues

Please use https://github.com/cokelaer/bioservices/issues

How to cite

Cokelaer et al. BioServices: a common Python package to access biological Web Services programmatically Bioinformatics (2013) 29 (24): 3241-3242

Documentation

RTD documentation.

Bioservices is a Python package that provides access to many Bioinformatices Web Services (e.g., UniProt) and a framework to easily implement Web Services wrappers (based on WSDL/SOAP or REST protocols).

The primary goal of BioServices is to use Python as a glue language to provide a programmatic access to several Bioinformatics Web Services. By doing so, elaboration of new applications that combine several of the wrapped Web Services is fostered.

One of the main philosophy of BioServices is to make use of the existing biological databases (not to re-invent new databases) and to alleviates the needs for expertise in Web Services for the developers/users.

BioServices provides access to about 40 Web Services.

Contributors

Maintaining BioServices would not have been possible without users and contributors. Each contribution has been an encouragement to pursue this project. Thanks to all:

https://contrib.rocks/image?repo=cokelaer/bioservices

Quick example

Here is a small example using the UniProt Web Service to search for the zap70 specy in human organism:

>>> from bioservices import UniProt
>>> u = UniProt(verbose=False)
>>> data = u.search("zap70+and+taxonomy_id:9606", frmt="tsv", limit=3,
...                 columns="id,length,accession, gene_names")
>>> print(data)
Entry name   Length  Entry   Gene names
ZAP70_HUMAN  619     P43403  ZAP70 SRK
B4E0E2_HUMAN 185     B4E0E2
RHOH_HUMAN   191     Q15669  RHOH ARHH TTF

Note

major changes of UniProt API changed all columns names in June 2022. The code above is valid for bioservices versions >1.10. Earlier version used:

>>> data = u.search("zap70+and+taxonomy:9606", frmt="tab", limit=3,
...                 columns="entry name,length,id, genes")

Note that columns names have changed, the frmt was changed from tab to tsv and taxonomy is now taxonomy_id. Names correspondences can be found in:

u._legacy_names

More examples and tutorials are available in the On-line documentation

Current services

Here is the list of services available and their testing status.

Service

CI testing

arrayexpress

https://github.com/cokelaer/bioservices/actions/workflows/arrayexpress.yml/badge.svg

bigg

https://github.com/cokelaer/bioservices/actions/workflows/bigg.yml/badge.svg

biocontainers

https://github.com/cokelaer/bioservices/actions/workflows/biocontainers.yml/badge.svg

biodbnet

https://github.com/cokelaer/bioservices/actions/workflows/biodbnet.yml/badge.svg

biogrid

https://github.com/cokelaer/bioservices/actions/workflows/biogrid.yml/badge.svg

biomart

https://github.com/cokelaer/bioservices/actions/workflows/biomart.yml/badge.svg

biomodels

https://github.com/cokelaer/bioservices/actions/workflows/biomodels.yml/badge.svg

chebi

https://github.com/cokelaer/bioservices/actions/workflows/chebi.yml/badge.svg

chembl

https://github.com/cokelaer/bioservices/actions/workflows/chembl.yml/badge.svg

cog

https://github.com/cokelaer/bioservices/actions/workflows/cog.yml/badge.svg

dbfetch

https://github.com/cokelaer/bioservices/actions/workflows/dbfetch.yml/badge.svg

ena

https://github.com/cokelaer/bioservices/actions/workflows/ena.yml/badge.svg

ensembl

https://github.com/cokelaer/bioservices/actions/workflows/ensembl.yml/badge.svg

eutils

https://github.com/cokelaer/bioservices/actions/workflows/eutils.yml/badge.svg

eva

https://github.com/cokelaer/bioservices/actions/workflows/eva.yml/badge.svg

hgnc

https://github.com/cokelaer/bioservices/actions/workflows/hgnc.yml/badge.svg

intact_complex

https://github.com/cokelaer/bioservices/actions/workflows/intact_complex.yml/badge.svg

kegg

https://github.com/cokelaer/bioservices/actions/workflows/kegg.yml/badge.svg

muscle

https://github.com/cokelaer/bioservices/actions/workflows/muscle.yml/badge.svg

mygeneinfo

https://github.com/cokelaer/bioservices/actions/workflows/mygeneinfo.yml/badge.svg

ncbiblast

https://github.com/cokelaer/bioservices/actions/workflows/ncbiblast.yml/badge.svg

omicsdi

https://github.com/cokelaer/bioservices/actions/workflows/omicsdi.yml/badge.svg

omnipath

https://github.com/cokelaer/bioservices/actions/workflows/omnipath.yml/badge.svg

panther

https://github.com/cokelaer/bioservices/actions/workflows/panther.yml/badge.svg

pathwaycommons

https://github.com/cokelaer/bioservices/actions/workflows/pathwaycommons.yml/badge.svg

pdb

https://github.com/cokelaer/bioservices/actions/workflows/pdb.yml/badge.svg

pdbe

https://github.com/cokelaer/bioservices/actions/workflows/pdbe.yml/badge.svg

pfam

https://github.com/cokelaer/bioservices/actions/workflows/pfam.yml/badge.svg

pride

https://github.com/cokelaer/bioservices/actions/workflows/pride.yml/badge.svg

psicquic

https://github.com/cokelaer/bioservices/actions/workflows/psicquic.yml/badge.svg

pubchem

https://github.com/cokelaer/bioservices/actions/workflows/pubchem.yml/badge.svg

quickgo

https://github.com/cokelaer/bioservices/actions/workflows/quickgo.yml/badge.svg

reactome

https://github.com/cokelaer/bioservices/actions/workflows/reactome.yml/badge.svg

rhea

https://github.com/cokelaer/bioservices/actions/workflows/rhea.yml/badge.svg

seqret

https://github.com/cokelaer/bioservices/actions/workflows/seqret.yml/badge.svg

unichem

https://github.com/cokelaer/bioservices/actions/workflows/unichem.yml/badge.svg

uniprot

https://github.com/cokelaer/bioservices/actions/workflows/uniprot.yml/badge.svg

wikipathway

https://github.com/cokelaer/bioservices/actions/workflows/wikipathway.yml/badge.svg

Note

Contributions to implement new wrappers are more than welcome. See BioServices github page to join the development, and the Developer guide on how to implement new wrappers.

Bioservices command

In version 1.8.2, we included a bioservices command. For now it has only one subcommand to download a NCBI accession number and possibly it genbank or GFF file (if available):

bioservices download-accession --accession K01711.1 --with-gbk

Changelog

Version

Description

1.11.1

1.11.0

  • Fix uniprot limitation of 25 results only (

  • For developers: all services are now refactorised to use services as an attribute rather than a parent class.

  • Remove ReactomeOld and ReactomeAnalysis (deprecated)

  • move rnaseq_ebi (deprecated) to attic for book_keeping

1.10.4

  • Fix v1.10.3 adding missing requirements.txt

1.10.3

  • Update pdb service to use v2 API

  • remove biocarta (website not accesible anymore)

  • Update Chembl (no API changes)

1.10.2

1.10.1

  • allow command line to download genbank and GFF

  • update pride module to use new PRIDE API (July 2022)

  • Fixed KEGG bug #225

1.10.0

  • Update uniprot to use the new API (june 2022)

1.9.0

  • Update unichem to reflect new API

1.8.4

  • biomodels. Fix #208

  • KEGG: fixed #204 #202 and #203

1.8.3

  • Eutils: remove warning due to unreachable URL. Set REST as attribute rather and inheritance.

  • NEW biocontainers module

  • KEGG: add save_pathway method. Fix parsing of structure/pdb entry

  • remove deprecated function from Reactome

1.8.2

  • Fix suds package in code and requirements

1.8.1

  • Integrated a change made in KEGG service (DEFINITON was changed to ORG_CODE)

  • for developers: applied black on all modules

  • switch suds-jurko to new suds community

1.8.0

  • add main standalone application.

  • moved chemspider and clinvitae to the attic

  • removed picr service, not active anymore

1.4.X

  • NEW RNAseq from EBI in rnaseq_ebi module

  • Replaced deprecated HGNC with the official web service from genenames.org

  • Fully updated EUtils since WSDL is now down; implementation uses REST now.

  • Removed the apps/taxonomy module now part of http://github.com/biokit.

1.3.X

  • CACHE files are now stored in a general directory in the home

  • New REST class to use requests package instead of urllib2.

  • Creation of a global configuration file in .config/bioservice/bioservices.cfg

  • NEW services: Reactome, Readseq, Ensembl, EUtils

1.2.X

  • NEW services: BioDBnet, BioDBNet, MUSCLE, PathwayCommons, GeneProf

1.1.X

  • NEW services: biocarta, pfam, ChEBI, UniChem

1.0.0:

  • first stable release

0.9.X:

  • NEW services: BioModels, Kegg, Reactome, Chembl, PICR, QuickGO, Rhea, UniProt,WSDbfetch, NCBIblast, PSICQUIC, Wikipath

Warning

Some of the services may be down. BioServices developers are not responsible for the maintenance or failure of underlying services. Generally speaking (and by experience) the services are up most of the time but failure may occur because the site is under maintenance or too many requests have been sent. Another common reason is the fact that the API of the web services has changed: If so, BioServices need to be updated. You may contribute or report such API changes on our Issue page

Installation

BioServices is available on PyPi, the Python package repository. The following command should install BioServices and its dependencies automatically provided you have pip on your system:

pip install bioservices

If not, please see the external pip installation page or pip installation entry. You may also find information in the troubleshootings page section about known issues.

Regarding the dependencies, BioServices depends on the following packages: BeautifulSoup4 (for parsing XML), SOAPpy and suds (to access to SOAP/WSDL services; suds is used by ChEBI only for which SOAPpy fails to correctly fetch the service) and easydev. All those packages should be installed automatically when using pip installer. Since version 1.6.0, we also make use of pandas and matplotlib to offer some extra functionalities.

User guide

Quick Start

Introduction

BioServices provides access to several Web Services. Each service requires some expertise on its own. In this Quick Start section, we will neither cover all the services nor all their functionalities. However, it should give you a good overview of what you can do with BioServices (both from the user and developer point of views).

Before starting, let us remind what are Web Services. There provide an access to databases or applications via a web interface based on the SOAP/WSDL or the REST technologies. These technologies allow a programmatic access, which we take advantage in BioServices.

The REST technology uses URLs so there is no external dependency. You simply need to build a well-formatted URL and you will retrieve an XML document that you can consume with your preferred technology platform.

The SOAP/WSDL technology combines SOAP (Simple Object Access Protocol), which is a messaging protocol for transporting information and the WSDL (Web Services Description Language), which is a method for describing Web Services and their capabilities.

What methods are available for a given service

Usually most of the service functionalities have been wrapped and we try to keep the names as close as possible to the API. On top of the service methods, each class inherits from the BioService class (REST or WSDL). For instance REST service have the useful request method. Another nice function is the onWeb.

See also

REST, WSDLService

What about the output ?

Outputs depend on the service and functionalities of the service. It can be heteregeneous. However, output are mostly XML formatted or in tabulated separated column format (TSV). When XML is returned, it is usually parsed via the BeautilSoup package (for instance you can get all children using getchildren() function). Sometimes, we also convert output into dictionaries. So, it really depends on the service/functionality you are using.

Let us look at some of the Web Services wrapped in BioServices.

UniProt service

Let us start with the UniProt class. With this class, you can access to uniprot services. In particular, you can map an ID from a database to another one. For instance to convert the UniProtKB ID into KEGG ID, use:

>>> from bioservices.uniprot import UniProt
>>> u = UniProt(verbose=False)
>>> u.mapping(fr="UniProtKB_AC-ID", to="KEGG", query='P43403')
{'results': [{'from': 'P43403', 'to': 'hsa:7535'}]}

Note that the returned response from uniprot web service is a dictionary with a key called results, which needs to be selected. Then, a list of identifiers is provided.

You can also search for a specific UniProtKB ID to get exhaustive information:

>>> print(u.search("P43403", frmt="txt"))
ID   ZAP70_HUMAN             Reviewed;         619 AA.
AC   P43403; A6NFP4; Q6PIA4; Q8IXD6; Q9UBS6;
DT   01-NOV-1995, integrated into UniProtKB/Swiss-Prot.
DT   01-NOV-1995, sequence version 1.
...

To obtain the FASTA sequence, you can use searchUniProtId():

>>> print(u.searchUniProtId("P09958", frmt="fasta"))
sp|P09958|FURIN_HUMAN Furin OS=Homo sapiens GN=FURIN PE=1 SV=2
MELRPWLLWVVAATGTLVLLAADAQGQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQI
FGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQ
QWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNH
ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCE
EGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETIRASVCAPCHASCATCQGPALTDCL
SCPSHASLDPVEQTCSRQSQSSRESPPQQQPPRLPPEVEAGQRLRAGLLPSHLPEVVAGL
SCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEG
RGERTAFIKDQSAL

See also

Reference guide of bioservices.uniprot.UniProt for more details

KEGG service

The KEGG interface is similar but contains more methods. The tutorial presents the KEGG itnerface in details, but let us have a quick overview. First, let us start a KEGG instance:

from bioservices import KEGG
k = KEGG(verbose=False)

KEGG contains biological data for many organisms. By default, no organism is set, which can be checked in the following attribute

k.organism

We can set it to human using KEGG terminology for homo sapiens:

k.organis = 'hsa'

You can use the dbinfo() to obtain statistics on the pathway database:

>>> print(k.info("pathway"))
pathway          KEGG Pathway Database
path             Release 65.0+/01-15, Jan 13
                 Kanehisa Laboratories
                 218,277 entries

You can see the list of valid databases using the databases attribute. Each of the database entry can also be listed using the list() method. For instance, the organisms can be retrieved with:

k.list("organism")

However, to extract the Ids extra processing is required. So, we provide aliases to retrieve the organism Ids easily:

k.organismIds

The human organism is coded as “hsa”. You can also get its T number instead:

>>> k.code2Tnumber("hsa")
'T01001'

Every elements is referred to with a KEGG ID, which may be difficult to handle at first. There are methods to retrieve the IDs though. For instance, get the list of pathways iIs for the current organism as follows:

k.pathwayIds

For a given gene, you can get the full information related to that gene by using the method get():

print(k.get("hsa:3586"))

or a pathway:

print(k.get("path:hsa05416"))

See also

Reference guide of bioservices.kegg.KEGG for more details

See also

KEGG Tutorial for more details

See also

Reference guide of bioservices.kegg.KEGGParser to parse a KEGG entry into a dictionary

QuickGO

To acces to the GO interface, simply create an instance and look for a entry using the bioservices.quickgo.QuickGO.Term() method:

>>> from bioservices import QuickGO
>>> g = QuickGO(verbose=False)
>>> print(g.Term("GO:0003824", frmt="obo"))
[Term]
id: GO:0003824
name: catalytic activity
def: "Catalysis of a biochemical reaction at physiological temperatures. In
biologically catalyzed reactions, the reactants are known as substrates, and the
catalysts are naturally occurring macromolecular substances known as enzymes.
Enzymes possess specific binding sites for substrates, and are usually composed
wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is
often also regarded as enzymatic."
synonym: "enzyme activity" exact
xref: InterPro:IPR000183
...

See also

Reference guide of bioservices.quickgo.QuickGO for more details

PICR service

PICR, the Protein Identifier Cross Reference service provides 2 services in WSDL and REST protocols. When it is the case, we arbitrary chose one of the available protocol. In the PICR case, we implemented only the REST interface. The methods available in the REST service are very similar to those available via SOAP except for one major difference: only one accession or sequence can be mapped per request.

The following example returns a XML document containing information about the protein P29375 found in two specific databases:

>>> from bioservices.picr import PICR
>>> p = PICR()
>>> res = p.getUPIForAccession("P29375", ["IPI", "ENSEMBL"])

See also

Reference guide of bioservices.picr.PICR for more details

BioModels service

You can access the biomodels service and obtain a model as follows:

>>> from bioservices import biomodels
>>> b = biomodels.BioModels()
>>> model = b.get_model('BIOMD0000000299')

Then you can play with the SBML file with your favorite SBML tool.

In order to get the model IDs, you can look at the full list:

>>> b.get_models()

See also

Reference guide of bioservices.biomodels.BioModels for more details

See also

Biomodels tutorial for more details

Rhea service

Create a Rhea instance as follows:

from bioservices import Rhea
r = Rhea()

Rhea provides only 2 type of requests with a REST interface that are available with the search() and query() methods. Let us first find information about the chemical product caffein using the search() method:

response = r.search("caffein*")

The output is a JSON file that we convert in BioServices into a Pandas dataframe.

The previous request returns more than 10,000 entries. Here are the first two entries:

    Reaction identifier                                           Equation             ChEBI name           Cross-reference (KEGG)  Cross-reference (Reactome)
0   RHEA:47148              a ubiquinone + caffeine + H2O = 1,3,7-trimethy...          MetaCyc:RXN-11523           KEGG:R07980                         NaN
1   RHEA:10280              1,7-dimethylxanthine + S-adenosyl-L-methionine...          MetaCyc:RXN-7601            KEGG:R07921                         NaN

The second method provided is the query() method. Given an Id, you can query the Rhea database using Id found earlier (e.g., 10280). This is finally a filtering method as compared to the search method. If you kow what your are looking for (the rhea-id) use this method instead of the search method:

info = r.query("10280", columns="rhea-id,equation", limit=10)

See also

Reference guide of bioservices.rhea.Rhea for more details

Other services

There are many other services provided within BioServices and the reference guide should give you all the information available with examples to start to play with any of them. The home page of the services themselves is usually a good starting point as well.

Services that are not available in BioServices can still be accesssed to quite easily as demonstrated in the Developer Guide section.

Tutorials

This section present the KEGG and BioModels services in more details. The Protein test case study illustrates how several services can be used to get lots of information about a specific protein. New Contributino to this section are welcomed.

KEGG Tutorial
Introduction

Start a kegg interface (default organism is human, that is called hsa):

from bioservices.kegg import KEGG
k = KEGG()

KEGG has many databases. The list can be found in the attribute bioservices.kegg.KEGG.databases. Each database can be queried with the bioservices.kegg.KEGG.list() method:

k.list("organism")

The output contains Id of the organism and some other information. To retrieve the Ids, you will need to process the output. However, we provide an alias:

print(k.organismIds)

In general, methods require an access to the on-line KEGG database therefore it takes time. For instance, the command above takes a couple of seconds. However, some are buffered so next time you call it, it will be much faster.

Another useful alias is the pathwayIds to retrieve all pathway Ids. However, you must first specify the organism you are interested in. From the command above we know that hsa (human) is valid organism Id, so let us set it and then get the list of pathways:

k.organism = "hsa"
k.pathwayIds

Another function provided by the KEGG API is the bioservices.kegg.KEGG.get() one that query a specific entry. Here we are interested into the human gene with the code 7535:

k.get("hsa:7535")    #hsa:7535 is also known as ZAP70

It is quite verbose and is a single string, which may be tricky to handle. We provide a tool to ease the parsing (see below and bioservices.kegg.KEGG.parse()) returned by bioservices.kegg.KEGG.parse().

Searching for an organism

The method bioservices.kegg.KEGG.find() is quite convenient to search for entries in different database. For instance, if you want to know the code of an entry for the gene called ZAP70 in the human organism, type:

>>> s.find("hsa", "zap70")
'hsa:7535\tZAP70, SRK, STCD, STD, TZK, ZAP-70; zeta-chain (TCR) associated protein kinase 70kDa (EC:2.7.10.2); K07360 tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]\n'

It is quite powerful and more examples will be shown. However, it has some limitations. For example, what about searching for the organism Ids that correspond to any Drosophila? It does not look like it is possible. BioServices provides a method to search for an organism Id using lookfor_organism() given the name (or part of it):

>>> k.lookfor_organism("droso")
['T00030 dme Drosophila melanogaster (fruit fly) Eukaryotes;Animals;Arthropods;Insects',
'T01032 dpo Drosophila pseudoobscura pseudoobscura Eukaryotes;Animals;Arthropods;Insects',
'T01059 dan Drosophila ananassae Eukaryotes;Animals;Arthropods;Insects',
'T01060 der Drosophila erecta Eukaryotes;Animals;Arthropods;Insects',
'T01063 dpe Drosophila persimilis Eukaryotes;Animals;Arthropods;Insects',
'T01064 dse Drosophila sechellia Eukaryotes;Animals;Arthropods;Insects',
'T01065 dsi Drosophila simulans Eukaryotes;Animals;Arthropods;Insects',
'T01067 dwi Drosophila willistoni Eukaryotes;Animals;Arthropods;Insects',
'T01068 dya Drosophila yakuba Eukaryotes;Animals;Arthropods;Insects',
'T01061 dgr Drosophila grimshawi Eukaryotes;Animals;Arthropods;Insects',
'T01062 dmo Drosophila mojavensis Eukaryotes;Animals;Arthropods;Insects',
'T01066 dvi Drosophila virilis Eukaryotes;Animals;Arthropods;Insects']
Look for pathways (by name)

Searching for pathways is quite similar. You can use the find method as above:

>>> print(s.find("pathway", "B+cell"))
path:map04112   Cell cycle - Caulobacter
path:map04662   B cell receptor signaling pathway
path:map05100   Bacterial invasion of epithelial cells
path:map05120   Epithelial cell signaling in Helicobacter pylori infection
path:map05217   Basal cell carcinoma

Note that without the + sign, you get all pathway that contains B or cell. Yet, we have 5 results, which do not neccesseraly fit our request. Alternatively you can use one of BioServices method:

>>> k.lookfor_pathway("B cell")
['path:map04662 B cell receptor signaling pathway']

You can also search for a pathway knowing some gene names but first we need to introspect the pathway to get the genes IDs.

Look for pathway (by genes i.e., IDs or usual name)

Imagine you want to find the pathway that contains ZAP70. As we have seen earlier you can get its gene Id as follows:

>>> s.find("hsa", "zap70")
hsa:7535

The following commands do not help:

>>> s.find("pathway", "zap70")
>>> s.find("pathway", "hsa:7535")
>>> s.find("pathway", "7535")

We provide a method to search for pathways that contain the required gene Id. You can search by KEGG Id or gene name:

>>> res = s.get_pathway_by_gene("7535", "hsa")
>>> s.get_pathway_by_gene("zap70", "hsa")
['path:hsa04064', 'path:hsa04650', 'path:hsa04660', 'path:hsa05340']

This commands first search for the gene Id in the KEGG database and then parse the output to retrieve the pathways.

Introspecting a pathway

Let us focus on one pathway ( path:hsa04660). You can use the get() command to obtain information about the pathway.

print(s.get("hsa04660"))

The output is a single string where you can recognise different fields such as NAME, GENE, DESCRIPTION and so on. This is quite limited. In BioServices, we provide a convenient parser that converts the output of the previous command into a dictionary:

>>> s = KEGG()
>>> data = s.get("hsa04660")
>>> dict_data = s.parse(data)
>>> print(dict_data['GENE'])
'10000': 'AKT3; v-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma) [KO:K04456] [EC:2.7.11.1]',
'10125': 'RASGRP1; RAS guanyl releasing protein 1 (calcium and DAG-regulated) [KO:K04350]',
'1019': 'CDK4; cyclin-dependent kinase 4 [KO:K02089] [EC:2.7.11.22]',
...

This is fine if we just want the name of the genes but what about their relations? Actually, there is an option with the get method where you can specify the output format. In particular you can request the pathway to be returned as a kgml file:

res = s.get("hsa04660", "kgml")

This file can be parsed to extract the relations. We provide a tool to do that:

res = s.parse_kgml_pathway("hsa04660")

The variable returned is a dictionary with 2 keys: “entries” and “relations”.

You can extract the relations as follows:

res['relations']

It is a list of relations, each relation being a dictionary:

>>> res['relations'][0]
{'entry1': u'61',
 'entry2': u'63',
 'link': u'PPrel',
 'name': u'binding/association',
 'value': u'---'}

Here entry1 and 2 are Ids. The Ids can be found in

res['entries']

From there you should consult bioservices.kegg.KEGG.parse_kgml_pathway() and the KEGG document for more information. You may also look at bioservices.kegg.KEGG.pathway2sif() method that extact only protein-protein interactions with activation and inhibition links only.

Building a histogram of all relations in human pathways

Scanning all relations of the Human organism takes about 5-10 minutes. You can look at a subset by setting Nmax to a small value (e.g., Nmax=10).

from pylab import *
# extract all relations from all pathways
from bioservices.kegg import KEGG
s = KEGG()
s.organism = "hsa"

# retrieve more than 260 pathways so it takes time
results = [s.parse_kgml_pathway(x) for x in s.pathwayIds]
relations = [x['relations'] for x in results]

hist([len(r) for r in relations], 20)
xlabel('number of relations')
ylabel('\#')
title("number of relations per pathways")
grid(True)
all_relations.png

You can then extract more information such as the type of relations:

>>> # scan all relations looking for the type of relations
>>> import collections # for python 2.7.0 and above

>>> # we extract from all pathways, all relations, where we retrieve the type of
>>> # relation (name)
>>> data = list(flatten([[x['name'] for x in rel] for rel in relations]))

>>> counter = collections.Counter(data)
>>> print(counter)
Counter({u'compound': 5235, u'activation': 3265, u'binding/association': 1087,
u'phosphorylation': 940, u'inhibition': 672, u'indirect effect': 559,
u'expression': 542, u'dephosphorylation': 93, u'missing interaction': 80,
u'dissociation': 78, u'ubiquitination': 48, u'state change': 24, u'repression':
12, u'methylation': 2})

See also

bioservices.biomodels.BioModels for the full reference guide.

Biomodels tutorial

Start a biomodels interface:

>>> from bioservices import BioModels
>>> s = BioModels()

look at the list of model identifiers:

models = s.get_all_models()

If you have a specific model identifier, then it is easy. You can retrieve the model itself:

model s.get_model("BIOMD0000000100")

and get its name or other types of information:

>>> model['name']
Rozi2003_GlycogenPhosphorylase_Activation

In particular, description, author and files associated with this model. Here, we can see the files and in particular a PNG image called BIOMD0000000100.png. You can get it as follows:

s.get_model_download("BIOMD0000000100", filename="BIOMD0000000100.png")

or just download the whole bundle:

s.get_model_download("BIOMD0000000100")

saved into BIOMD0000000100.zip.

Protein test case study

Application: retrieving information about a given protein

This section uses BioServices to demonstrate the interest of combining several services together within a single framework using the Python language as a glue language.

In this tutorial we are interested in using BioServices to obtain information about a specific protein. Let us focus on ZAP70 protein (homo sapiens).

Get a unique identifier and gene names from a name

From Uniprot, we can obtain the unique accession number of ZAP70, which may be useful later on. Let us try to use the search() method:

>>> from bioservices import *
>>> u = UniProt(verbose=False)
>>> u.search("ZAP70_HUMAN") # could be lower case

The default format of the returned answer is “tabulated”:

>>> res = u.search("ZAP70_HUMAN", frmt="tab")
>>> print(res)
Entry   Entry name  Status  Protein names   Gene names  Organism    Length
P43403  ZAP70_HUMAN reviewed    Tyrosine-protein kinase ZAP-70 (EC 2.7.10.2) (70 kDa zeta-chain associated protein) (Syk-related tyrosine kinase)    ZAP70 SRK Homo sapiens (Human)    619

It is better, but let us simplify even further. In BioServices, the output of the tabulated format contains several columns but we can select only a subset such as the Entry (accession number) and the gene names, which are coded as “id” and “genes” in uniprot database:

>>> res = u.search("ZAP70_HUMAN", frmt="tab", columns="id,genes")
>>> print(res)
Entry   Gene names
P43403  ZAP70 SRK

So here we got the Entry P43403. Entry and Gene names can be saved in two variables as follows:

>>> res = u.search("ZAP70_HUMAN", frmt="tab", columns="id,genes")
>>> entry, gene_names = res.split("\n")[1].split("\t")
Getting the fasta sequence

It is then straightforward to obtain the FASTA sequence of ZAP70 using another method from the UniProt class called retrieve():

>>> sequence = u.retrieve("P43403", "fasta")
>>> print(sequence)
>sp|P43403|ZAP70_HUMAN Tyrosine-protein kinase ZAP-70 OS=Homo sapiens OX=9606 GN=ZAP70 PE=1 SV=1
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
AQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARIT
SPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMR
KKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG
PLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDF
GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPY
KKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSL
ASKVEGPPGSTQKAEAACA

Note

There are many services that provides access to the FASTA sequence. We chose uniprot but you could use the Entrez utilities as well as other services.

Using BLAST on the sequence

You can then analyse this sequence with your favorite tool. As an example, within BioServices you can use NCIBlast but first let us extract the sequence itself (without the header):

sequence = sequence.split("\n", 1)[1].strip("\n")

then,

>>> s = NCBIblast(verbose=False)
>>> jobid = s.run(program="blastp", sequence=sequence, stype="protein", \
...    database="uniprotkb", email="cokelaer@ebi.ac.uk")
>>> print(s.getResult(jobid, "out")[0:1000])
BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= EMBOSS_001
         (619 letters)

Database: uniprotkb
           32,727,302 sequences; 10,543,978,207 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SP:ZAP70_HUMAN P43403 Tyrosine-protein kinase ZAP-70 OS=Homo sap...  1279   0.0
TR:H2QIE3_PANTR H2QIE3 Tyrosine-protein kinase OS=Pan troglodyte...  1278   0.0
TR:G3QGN8_GORGO G3QGN8 Tyrosine-protein kinase OS=Gorilla gorill...  1278   0.0
TR:G1QLX3_NOMLE G1QLX3 Tyrosine-protein kinase OS=Nomascus leuco...  1249   0.0
TR:F6SWY7_CALJA F6SWY7 Tyrosin

The last command waits for the job to be finised before printing the results, which may be quite long. We could look at the beginnin of the reported results and select only HUMAN sequences to see that the best sequence found is indeed ZAP70_HUMAN as expected:

>>> [x for x in s.getResult(jobid, "out").split("\n") if "HUMAN" in x]
['SP:ZAP70_HUMAN P43403 Tyrosine-protein kinase ZAP-70 OS=Homo sap...  1279 0.0  ',
 'SP:KSYK_HUMAN P43405 Tyrosine-protein kinase SYK OS=Homo sapiens...   691 0.0  ',
 'TR:A8K4G2_HUMAN A8K4G2 Tyrosine-protein kinase OS=Homo sapiens P...   691 0.0  ',
...
Searching for relevant pathways

The KEGG services provides pathways, so let try to find pathways that contains our targetted protein. First we need to know the KEGG Id that corresponds to ZAP70. We can use the find method form KEGG service:

>>> from bioservices import KEGG
>>> k = KEGG(verbose=False)
>>> k.find("hsa", "zap70")  # "hsa" stands for homo sapiens
hsa:7535 ZAP70, SRK, STCD, STD, TZK, ZAP-70; zeta-chain (TCR) associated protein kinase 70kDa (EC:2.7.10.2); K07360 tyrosine-protein kinase ZAP-70 [EC:2.7.10.2

There are other ways to perform this conversion using the bioservices.uniprot.UniProt.mapping() or bioeservices.KEGG.conv() methods (e.g., textit{k.conv(“hsa”, “up:P43403”)}).

Now, let us get the pathways that contains this ID:

>>> k.get_pathway_by_gene("7535", "hsa")
{'hsa04064': ' NF-kappa B signaling pathway',
'hsa04650': 'Natural killer cell mediated cytotoxicity',
 'hsa04660': 'T cell receptor signaling pathway',
 'hsa05340': 'Primary immunodeficiency'}

We can look at the first pathway in a browser (highlighting the ZAP70 node):

>>> k.show_pathway("hsa04064", keggid={"7535": "red"})
Searching for binary Interactions

For this purpose, we could use PSICQUIC services to find the interactions that involve ZAP70 in the mint database:

>>> from bioservices import PSICQUIC
>>> s = PSICQUIC(verbose=False)
>>> data = s.query("mint", "ZAP70 AND species:9606")

where 9606 is the taxonomy Id for homo sapiens. We could also figure out how many interactions could be found in each dabase for this particular query:

>>> s.getInteractionCounter("zap70 AND species:9606")
{'apid': 82,
 'bar': 0,
 'bind': 4,
 'bindingdb': 29,
 'biogrid': 73,
 'chembl': 161,
 'dip': 0,
 'i2d-imex': 0,
 'innatedb': 13,
 'innatedb-imex': 0,
 'intact': 11,
 'interoporc': 0,
 'irefindex': 273,
 'matrixdb': 0,
 'mbinfo': 0,
 'mint': 34,
 'molcon': 0,
 'mpidb': 0,
 'reactome': 0,
 'reactome-fis': 134,
 'spike': 47,
 'string': 319,
 'topfind': 0,
 'uniprot': 0}

We see for instance that the mint database has 34 interactions. Coming back to the interactions returned by s.query, we find indeed 34 intercations between ZAP70 and another component:

>>> len(data)
34

Let us look at the first one:

>>> for x in data[0]: print(x)
uniprotkb:P15498
uniprotkb:P43403
-
-
uniprotkb:VAV1(gene name)|uniprotkb:VAV(gene name synonym)
uniprotkb:ZAP70(gene name)|uniprotkb:SRK(gene name synonym)|uniprotkb:70 kDa
zeta-associated protein(gene name synonym)|uniprotkb:Syk-related tyrosine
kinase(gene name synonym)
psi-mi:"MI:0019"(coimmunoprecipitation)
-
pubmed:9151714
taxid:9606(Homo sapiens)
taxid:9606(Homo sapiens)
psi-mi:"MI:0914"(association)
psi-mi:"MI:0471"(mint)
mint:MINT-8035351
mint-score:0.28(free-text)|homomint-score:0.28(free-text)'intact-miscore:0.60']

The First two elements are the entries for specy A and B. The last element is the score. The 11th element is the type of interaction and so on.

What could be useful is to convert these elements into uniprot ID only. With mint database it is irrelevant for this particular entry but with other DBs or entries, it may be useful (e.g., biogrid).

BioServices provides such a function called convert():

>>> data = s.query("biogrid", "ZAP70 AND species:9606")
>>> data2 = s.convert(data, "biogrid")

Warning

some databases may be offline. If so, try we another database. Type “s.activeDBs”.

convert method converts all entries from data into uniprot ID. If this is not possible, the entry is removed. The query and convert works on a single database but you we could query all or a subset of all databases using the queryAll and convertAll functions:

>>> data = s.queryAll("ZAP70 AND species:9606", databases=["mint", "biogrid"])
>>> data2 = s.convertAll(data)

However, extra cleaning is required to remove entries that are not relevant (no match to uniprot ID, redundant, not a protein, self interactions, …). In order to ease this tast, the psicquic.AppsPPI class is very useful.

from bioservices import psicquic
s = psicquic.AppsPPI()
s.queryAll("ZAP70 AND species:9606", databases=["mint", "biogrid", "intact", "reactome-fis"])
s.summary()
s.show_pie()

(Source code)

The summary function print a useful summary about the number of found interactions and overlap between databases:

 >>> s.summary()
 Found 8 interactions within intact database
 Found 124 interactions within reactome-fis database
 Found 19 interactions within mint database
 Found 67 interactions within biogrid database
 -------------
 Found 152 interactions in 1 common databases
 Found 14 interactions in 2 common databases
 Found 0 interactions in 3 common databases
 Found 1 interactions in 4 common databases

This may be different depending on the available databases. Finally, you can obtain the relation that was found in the 4 databases:

 >>> s.relevant_interactions[4]
 [['LCK_HUMAN', 'ZAP70_HUMAN']]
What’s next ?

There are lots of other services that could be usefule. An example is the wikipathway (see Wikipathway) to retrieve even more pathways that include the ZAP70 protein. Another example is the BioMart portal. You could use it to retrieve pathways from REACTOME (see BioMart). You can also retrieve target from ChEMBL given the uniprot ID ( get_target_by_uniprotId(“P43403”) ) and so on.

Manipulating compound identifiers

Application: retrieving information about a compound

This section uses BioServices to demonstrate the interest of combining several services together within a single framework using the Python language as a glue language

Retrieve a compound identifier from KEGG, ChEBI and ChEMBL

Let us look at a compound called Geldanamycin that inhibits Hsp90. Let us search for information about that compound in several databases and manipulate the different identifiers.

First, let us retrieve information on KEGG database:

>>> from bioservices import *
>>> k = KEGG(verbose=False)

KEGG compounds have links to other databases. It is not systematic but the ChEBI database is often referenced. So we will want to convert the KEGG identifer to a ChEBI identifier. Later, we can convert a ChEBI to a ChEMBL identifier using another Web Service such as UniChem.

We can get a mapping dictionary from the KEGG compound to ChEBI as follows:

>>> map_kegg_chebi = k.conv("chebi", "compound")
>>> len(map_kegg_chebi) 
15845

>>> print(k.find("compound", "geldanamycin"))
cpd:C11222  Geldanamycin
cpd:C15823  Progeldanamycin

Let us look at the first one (KEGG id cpd:C11222). We can get lots of information from KEGG already by using:

>>> print(k.get("C11222"))

Form which, there is a link to other databases in particular ChEBI (ChEBI:5292). We could use the mapping dictionary created above:

>>> map_kegg_chebi['cpd:C11222']
'chebi:5292'

Unfortunately, there is no mapping function from KEGG to ChEMBL in KEGG Web Service.

However, BioServices provides access to the bioservices.unichem service. This service provides a useful mapping function from kegg to chembl:

>>> uni = UniChem()
>>> mapping = uni.get_mapping("kegg_ligand", "chembl")
>>> mapping['C11222']
'CHEMBL278315'

For sanity check, let us see that the ChEBI is indeed 5292 as given within the KEGG database:

>>> uni = UniChem()
>>> mapping = uni.get_mapping("kegg_ligand", "chebi")
>>> mapping['C11222']
'5292'

(2) In order to convert KEGG gene names into uniprot gene name, we can also use the UniProt web service from BioServices as follows:

>>> from bioservices import *
>>> u = UniProt()
>>> u.mapping(fr='ID', to='KEGG_ID', query="ZAP70_HUMAN")
{'ZAP70_HUMAN':  'hsa:7535'}

You can get accession number or protein name identifier from the KEGG identifier as follows:

>>> u.mapping(fr='KEGG_ID', to='ID', query='hsa:7535')
{'hsa7535': 'ZAP70_HUMAN'}
>>> u.mapping(fr='KEGG_ID', to='ACC', query='hsa:7535')
{'hsa7535': 'P43403'}
Mapping identifiers

There are quite a few functions from different Web Services that can help to map identifiers from one database to the other. This tutorial presents some of them.

Convert from KEGG ID to ChEBI (compound)
>>> from bioservices import *
>>> k = KEGG(verbose=False)
>>> map_kegg_chebi = k.conv("chebi", "compound")
>>> map_kegg_chebi['cpd:C11222']
'chebi:5292'
convert from KEGG ID to UniProt and vice versa (gene)

In order to convert KEGG gene names into uniprot gene name, we can also use the UniProt web service from BioServices as follows:

>>> from bioservices import *
>>> u = UniProt()
>>> u.mapping(fr="UniProtKB_AC-ID", to="KEGG", query='P43403')
{'results': [{'from': 'P43403', 'to': 'hsa:7535'}]}

You can get accession number or protein name identifier from the KEGG identifier as follows:

Due to an API change in 2022 and for back compatiblity, the mapping from KEGG to e.g. uniprot is a bit more complex than it used to be. First, the conversion:

>>> res = u.mapping(fr='KEGG', to='UniProtKB', query='hsa:7535')

Then, we extract the results (the first element) and the ‘to’ key. We can then extract e.g. the uniprot ID

>>> res['results'][0]['to']['uniProtkbId']
'ZAP70_HUMAN'

and the primary accession as follows:

>>> res['results'][0]['to']['primaryAccession']
'P43403'

One can also use the bioservices.kegg.KEGG.conv() method:

>>> k = KEGG()
>>> mapping_kegg_uniprot = k.conv("hsa", "uniprot")
BioMart service

BioMart provides a uniform interface to many services such as Cosmic, Ensembl and many more. In BioMart terminology a service is called a mart. As an example, we will consider the COSMIC interface provided by BioMart (see COSMIC). You can play with the interface itself to get an idea of what can be selected (e.g., datasets, filters, attributes). To help you, let us give a simple example that consists in converting the ensemble identifiers into entrez identifiers.

First you create an instance. There are lots of services behind the scene. The ENSEMBL_MART_ENSEMBL provides the conversion we are looking for.

from bioservices import BioMart
b = BioMart()
datasets = b.get_datasets("ENSEMBL_MART_ENSEMBL")

In datasets, there is a hsapiens_gene_ensembl database. Let us add it to the request that will be send:

b.add_dataset_to_xml(dataset)

We want to extract only the to following attributes:

b.add_attribute_to_xml("ensemble_gene_id")
b.add_attribute_to_xml("entrezgene_id")

If you are interested in a set of identifiers, provide it as a list (here below the queries:

queries = ["", ""]
b.add_filter_to_xml("ensemble_gene_id", queries)

and finally do the query itself:

xml = b.get_xml()
res = b.query(xml)

You can obtain the attributes and filters of a dataset as follows:

dataset = 'hsapiens_gene_ensembl'
attributes = b.attributes(dataset)
filters = b.filters(dataset)

Here is another example with cosmic.

Note

the cosmic mart was available at the time of 1.0 but not during release 1.4.1 . This is not a BioServices issue but the COSMIC mart being down. Hopefully, it will be available again soon. meanwhile this example should help you get a feeling of what can be done with a MART.

In BioServices, you can create a biomart request (which is a XML document) but first we need to figure out what are the datasets associated with the COSMIC mart. The tricky part is to know the names of the datasets/attributes/filters. BioServices provides a function that ease this task. First let create an instance of BioMart:

>>> from bioservices import *
>>> s = BioMart()

Then, let us use the lookfor() as follows:

>>> s.lookfor("cosmic")
Candidate:
     database: cosp
    MART name: CosmicMart
  displayName: COSMIC (SANGER UK)
        hosts: www.sanger.ac.uk

From the previous command, only one mart has been found. It is called CosmicMart, from which we can retrieve the datasets:

>>> s.datasets("CosmicMart")
['COSMIC67', 'COSMIC68', 'COSMIC66']

The are lots of entries in such datasets and we want to restrict our request using filters and attributes. Let us use the “COSMIC60” dataset. The following commands can help you in figuring out what are the valid names of attributes and filters to be used:

>>> s.attributes("COSMIC67")
>>> s.filters("COSMIC67")

They return list of dictionaries that provide the identifiers (keys of the dictionary) and information about the identifier (e.g. descriptive name).

For instance, if you want to add the gene name in the list of attributes, you will need to know its identifier. If you look at the dictionary you will find the “gene_name” key that contains:

>>> s.attributes("COSMIC67")["gene_name"]
['Gene Name',
 '',
 'naive_attributes',
 'html,txt,csv,tsv,xls',
 'COSMIC67__MART__MAIN',
 'gene_name']

So if you want to add the Gene Name attribute, you must use the gene_name identifier. Similarly for filters. In order to use a filter you must use the identifier as well as a value. Values are contained in the dictionary returned by filters(). For instance, the “Mutated Sample” filter given by the “samp_gene_mutated” identifier returns a list, which second element contains the list of valid values (here y or n character):

>>> s.filters("COSMIC67")
['Mutated Sample',
 '[y,n]',
 '',
 'naive_filters',
 'list',
 '=',
 'COSMIC67__MART__MAIN',
 'samp_gene_mutated']

So, there is a little bit of work for the user to figure out the identifiers of the attributes and filters. This could be a good exercice but let us give the list of relevant identifiers and there names that we want to use in this tutorial:

category

name

identifier

filter

Mutated Sample

samp_gene_mutated (y)

filter

Primary Site

site_primary (breast)

filter

Validation Status

validation_status (verified)

Attribute

Cosmic Sample ID

id_sample

Attribute

Sample Name

sample_name

Attribute

Sample Source

sample_source

Attribute

Tumour source

tumour_source

Attribute

Gene Name

gene_name

Attribute

Accession Number

accession_number

Attribute

Cosmi Mutation ID

id_mutation

Attribute

Gene ID

id_gene

It is now time to create the XML request by adding attributes/filters and the dataset:

>>> # add the dataset
>>> s.add_dataset_to_xml("COSMIC67")

>>> # add the attributes
>>> s.add_attribute_to_xml("id_sample")
>>> s.add_attribute_to_xml("sample_name")
>>> s.add_attribute_to_xml("sample_source")
>>> s.add_attribute_to_xml("tumour_source")
>>> s.add_attribute_to_xml("gene_name")
>>> s.add_attribute_to_xml("accession_number")
>>> s.add_attribute_to_xml("id_mutation")
>>> s.add_attribute_to_xml("id_gene")

>>> # add the filters
>>> s.add_filter_to_xml("samp_gene_mutated", "y")
>>> s.add_filter_to_xml("site_primary", "breast")
>>> s.add_filter_to_xml("validation_status", "verified")

You can create the XML request that will be send:

>>> xml = s.get_xml()

And finally send the request:

>>> res = s.query(xml)
GeneProf tutorial

GeneProf tutorial

New in version 1.2.0.

Section author: Thomas Cokelaer, Dec 2013

GeneProf is a web-based, graphical software suite that allows users to analyse data produced using high-throughput sequencing platforms (RNA-seq and ChIP-seq; “Next-Generation Sequencing” or NGS): Next-gen analysis for next-gen data

BioServices uses the GeneProf Web Services to enable programmatic access to the public data stored in GeneProf’s databases via Python.

Note

GeneProf services is quite versatile and contains many resources and examples. For any technical or scientific questions related to the service itself, please see GeneProf About&Help.

Here below you will find a couple of examples related to GeneProf.

Histogram expression data
Reference

https://www.geneprof.org/GeneProf/media/bpsm-2013/

In the example below, we use geneprof to

  1. search for Gene identifiers related to an organism (mouse) and keyword (nanog).

  2. From the gene identifiers, retrieve the gene expression values for a given gene in all experiments

  3. plot histogram of the log values found above.

Note

broken example on June 2017. Service should be fix soon. Issue reported to the author.

>>> from bioservices import GeneProf
>>> g = GeneProf(verbose=True)
>>> res = g.search_gene_ids("nanog", "mouse")
>>> print(res)
{10090: [29640, 14899]}
>>> expr1 = g.get_expression("mouse", 29640)['values']
>>> expr2  = g.get_expression("mouse", 14899)['values']

>>> import math
>>> values1 = [math.log(x["RPKM"]+1, 2.) for x in expr1]
>>> values2 = [math.log(x["RPKM"]+1, 2.) for x in expr2]

>>> from pylab import clf, subplot, hist
>>> clf()
>>> subplot(2,1,1)
>>> hist(values1)
>>> subplot(2,1,2)
>>> hist(values2)
Transcription factor network of stem cells
References

https://www.geneprof.org/GeneProf/media/recomb-2013/

Another example, here below consists in retrieving the binding targets of transcription factors (about 70) in mouse embryonic stem cells, and generate a SIF network that could be open and visualised in Cytoscape.

The example below can probably be simplified and make use of tools such as networkx to manipulate and visualise the final network. Please use with care:

>>> # first import and create a GenProf instance
>>> from bioservices import GeneProf
>>> g = GeneProf(verbose=False)
>>>
>>> # find all pubic experimental mouse samples in geneprof
>>> samples = g.get_list_experiment_samples("mouse")['samples']
>>> # look at entries that contains "Gene"
>>> graph = {}
>>> mapgene = {}
>>> for i, entry in enumerate(samples):
...     print("progress %s/%s" % (i+1, len(samples)))

...     # keep only entries that have cell type "embryonic stem cell" in the celltype
...     if "Gene" in entry.keys() and "Cell_Type" in entry.keys() and entry["Cell_Type"]=="embryonic stem cell":
...
...         # aliases
...         sampleId = entry['sample_id']
...         gene = entry["Gene"]

...         # get gene id and save mapping in a dictionary to be used later
...         geneId = g.get_gene_id("mouse",  "C_NAME", gene)['ids']
...         mapgene[geneId[0]] = gene

...         # get targets and print them
...         targets =  g.get_targets_by_experiment_sample("mouse", sampleId)

...         # could be simplied inside the geneprof.py module
...         if 'targets' in targets.keys():
...             targets = targets['targets']

...         # print the results
...         for x in targets:
...             print gene, geneId[0], " ", x['feature_id']
...         graph[gene] = [x['feature_id'] for x in targets]

>>> # The graph saved in the graph variables is quite large. Let us simplified keeping target that
>>> # are in the list of genes only
>>> simple_graph = {}
>>> for k, v in graph.iteritems():
...     simple_graph[k] = [mapgene[x] for x in v if x in mapgene.keys()]
>>> len(simple_graph.keys())
72
>>> sum([len(simple_graph[x]) for x in simple_graph.keys()])
2137

Finally, you can look at the graph with your favorite tool such as Cytoscape, Gephi.

Here below, I’m using a basic graph visualisation tool implemented in CellNOpt, which is not dedicated for Network visualisation but contains a small interface to graphviz useful in this context (it has a python interface):

>>> from cno import CNOGraph
>>> c = CNOGraph()
>>> for k in simple_graph.keys():
...     for v in simple_graph[k]:
...         c.add_edge(k, v, link="+")
>>> c.centrality_degree()
>>> c.graph['graph'] = {"splines":"true", "size":(20,20),
    "dpi":200, "fixedsize":True}
>>> c.graph['node'] = {"width":.01, "height":.01,
    'size':0.01, "fontsize":8}
>>> c.plotdot(prog="fdp", node_attribute="degree")
geneprof_network.png
Integrating expression data in pathways
References

https://www.geneprof.org/GeneProf/media/recomb-2013/

This is another example from the reference above but based on tools available in bioservices so as to overlaid highthroughput gene expression onto pathways and models from KEGG database.

Fold changes in lymphoma vs. kidney on selected KEGG pathways

>>> from bioservices import KEGG, GeneProf, UniProt
>>> import StringIO
>>> import pandas
>>> g = GeneProf()
>>> k = KEGG()
>>> u = UniProt()

>>> # load ENCODE RNA-seq into a DataFrame for later
>>> data = g.get_data("11_683_28_1", "txt")
>>> rnaseq = pandas.read_csv(StringIO.StringIO(data), sep="\t")
>>> gene_names = rnaseq['Ensembl Gene ID']

>>> # get a pathway diagram for the KEGG path hsa05202 ("Transcriptional
>>> # misregulation in cancers")
>>> res = k.parse(k.get("hsa05202"))
>>> # extract KEGG identifiers corresponding to the genes found in the pathway
>>> keggids = ["hsa:"+x for x in res['GENE'].keys()]

>>> # we need to map the KEGG Ids to Ensembl Ids. We will use KEGG mapping and uniprot mapping
>>> # for cases where the former does not have associated mapping.
>>> ensemblids = {}
>>> for id_ in keggids:
...     res = k.parse(k.get(id_))['DBLINKS']
...     if 'Ensembl' in res.keys():
...         print id_, res['Ensembl']
...         ensemblids[id_] = res['Ensembl']
...     else:
...         if "UniProt" in res.keys():
...             ids = res['UniProt'].split()[0]
...             m = u.mapping("ACC", "ENSEMBL_ID", query=ids)
...             if len(m): ensemblids[id_] = m[ids][0]
...         pass # no links to ensembl DB found

>>> # what are the KEGG id transformed into Ensembl Ids that are in the ENCODE data set ?
>>> found = [x for x in ensemblids.values() if x in [str(y) for y in gene_names]]
>>> indices = [i for i, x in enumerate(rnaseq['Ensembl Gene ID']) if x in found]
>>>
>>> # now, we can pick out the log2 fold change values for visualization:
>>> data = rnaseq.ix[indices][['Ensembl Gene ID', 'log2FC Lymphoma / EmbryonicKidney']]
>>> # and keep only those that have a negative or positive value
>>> mid = 1.5
>>> low = data[data['log2FC Lymphoma / EmbryonicKidney']<-mid]
>>> geneid_low = list(low['Ensembl Gene ID'])
>>> up = data[data['log2FC Lymphoma / EmbryonicKidney']>mid]
>>> geneid_up = list(up['Ensembl Gene ID'])
>>> mid = data[abs(data['log2FC Lymphoma / EmbryonicKidney'])<mid]
>>> geneid_mid = list(mid['Ensembl Gene ID'])

>>> # now that we have the genes (in ensembl format), we need the kegg id
>>> keggid_low = [this for this in keggids if ensemblids[this] in geneid_low]
>>> keggid_mid = [this for this in keggids if ensemblids[this] in geneid_mid]
>>> keggid_up = [this for this in keggids if ensemblids[this] in geneid_up]
>>> # it is now time to look at the expression on the diagram
>>> colors = {}
>>> for id_ in keggids:  colors[id_[4:]] = "gray,"
>>> for id_ in keggid_low: colors[id_[4:]] = "blue,"
>>> for id_ in keggid_up:  colors[id_[4:]] = "orange,"
>>> for id_ in keggid_mid: colors[id_[4:]] = "yellow,"
>>> k.show_pathway("hsa05202", dcolor="white", keggid=colors)

The last command will popup the KEGG diagram with the expression data on top of the diagram, as shown in the following picture:

geneprof_kegg_expression.png

Combining BioServices with external tools

This section shows how to use BioServices as an intermediate tool that fetch data to be used by third-party software/application.

The external applications used in this section are not part of BioServices therefore we do not provide instructions for the installation. Reader should refer to the application web site instead (URLs are provided here below). However, we indicate the way we installed them.

PYMOL
URL

http://www.pymol.org/

This example below uses the external software called PyMOL. We have installed it without trouble by downloading the source file from their website. Then, we typed those commands in a shell:

bunzip pymol-v1.6alpha1.tar.bz2
tar xvf pymol-v1.6alpha1.tar
cd pymol
python setup.py install

You may need to install library if requested. Tested under Fedora 15.

conda install -c schrodinger pymol-bundle

The following code uses BioServices to get the PDB Identifier of a protein called ZAP70. To do so, we use bioservices.uniprot.UniProt to get its accession number (P43403) and its PDB identifer. Then, we use bioservices.pdb.PDB to get the 3D structure in PDB format.

The script above uses PyMOL in a script manner to save the 3D graphical representation of the protein (here below) but you could also use PyMOL in an interactive mode.

_images/pymol.png
BioPython
URL

http://biopython.org/DIST/docs/tutorial/Tutorial.html#chapter:Bio.AlignIO

BioPython provides many tools for IO, algorithms and access to Web services. BioServices provides access to many web services. This example shows how (i) to use BioServices to retrieve FASTA files and (ii) BioPython to play with the sequences.

Note

We assume you have installed BioPython (pip install biopython)

First, let us retrieve two FASTA sequences and save them in 2 files:

from bioservices import UniProt
u = UniProt()
akt1 = u.retrieve("P31749", "fasta")
akt2 = u.retrieve("P31751", "fasta")

fh = open("akt1.fasta", "w")
fh.write(akt1)
fh.close()

fh = open("akt2.fasta", "w")
fh.write(akt2)
fh.close()

Now, on the BioPython side, we read the 2 sequences and introspect them:

>>> from Bio import AlignIO
>>> record1 = SeqIO.read("akt1.fasta", "fasta")
>>> record2 = SeqIO.read("akt2.fasta", "fasta")
>>> record1 += "-"   # this is to have 2 sequences on same length as requested by the following function

>>> alignment = AlignIO.MultipleSeqAlignment([])
>>> alignment.append(record1)
>>> alignment.append(record2)

>>> for record in alignment:
>>>     print(description)
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2

You are ready to play with BioPython multiple alignment tools. Please consult BioPython documentation for more examples.

Galaxy
URL

http://wiki.galaxyproject.org/FrontPage

Date

Aug 2013

Galaxy is an open, web-based platform for accessible, reproducible, and transparent computational biomedical research. It provides worflows and plugins to many web resources.

This tutorial shows how to link bioservices and galaxy. Our tutorial will provide a plugin to Galaxy so that a user can retrieve a FASTA file via BioServices and the wrapping of UniProt Web Services.

We assume that you installed Galaxy on your system via the source code:

hg clone https://bitbucket.org/galaxy/galaxy-dist/
cd galaxy-dist
hg update stable

The tree directory should therefore contains a directory called tools/ and in the main directory, an XML file called conf_tools.py

We will first create a plugin for bioservices. This is done by adding a directory called bioservices in ./tools:

mkdir tools/bioservices

In this directory, we will create two files called uniprot.py that will contain the actual code that calls bioservices and a second XML file that will allows us to design the plugin layout.

Let us start with the plugin. It is very simple since only the UniProt Entry is required. The output will simply be the FASTA file that would have been fetched.

The XML file is:

<tool id="bioservices_uniprot" name="Get FASTA" version="1.1.0">
  <description>from UniProt via Bioservices</description>
  <requirements>
    <requirement type="package">bioservices</requirement>
  </requirements>
  <command interpreter="python">uniprot.py $uniprot_id $output</command>
  <inputs>
    <param name="uniprot_id" type="text" label="UniProt ID" size="40" help="Provide a valid UniProt Entry (e.g. P43403) "/>
  </inputs>
  <outputs>
    <data format="fasta" name="output" />
  </outputs>
  <help>
Fetch a FASTA file using UniProt via BioServices. Simply provide a valid Uniprot Entry (e.g., P43403)
  </help>
</tool>

The python code will take as an input the UniProt ID and create a file that contains the FASTA data:

import sys

def __main__():
    ids = sys.argv[1]
    filename = sys.argv[2]
    # TODO: check the validity and format ? 
    try:
        from  bioservices import UniProt
        u = UniProt(verbose=False)
        u.debugLevel = "ERROR"
    except ImportError:
        print("Could not import bioservoces ? Check that it is installed. Try 'pip install bioservices'")

    try:
        fasta = u.searchUniProtId(ids, "fasta")
    except:
        print("An error occured while fetching the FASTA file from uniprot")

    try:
        fh = open(filename, "w")
        fh.write(fasta)

finally, you need to make Galaxy aware of this new plugin. this is done in the file called conf_tool.xml. Add bioservices plugin. The beginning of the file should look like:

<?xml version="1.0"?>
 <toolbox>
   <section name="Get Data" id="getext">
     <tool file="bioservices/uniprot.xml"/>
     <tool file="data_source/upload.xml"/>
...

Once done. start you galaxy server. The following image show the outcome: in the left hand side, you can select the bioservices plugin. Then, in the center, you can enter a uniprot entry. Press the execute button and the new file should appear in the right hand side. From there you can use Galaxy other tools to analyse the file.

_images/galaxy.png

This example shows that it is possible to link Galaxy and BioServices to access to various Web Services that are available through Bioservices.

PYMOL
URL

http://www.pymol.org/

This example below uses the external software called PyMOL. We have installed it without trouble by downloading the source file from their website. Then, we typed those commands in a shell:

bunzip pymol-v1.6alpha1.tar.bz2
tar xvf pymol-v1.6alpha1.tar
cd pymol
python setup.py install

You may need to install library if requested. Tested under Fedora 15.

conda install -c schrodinger pymol-bundle

The following code uses BioServices to get the PDB Identifier of a protein called ZAP70. To do so, we use bioservices.uniprot.UniProt to get its accession number (P43403) and its PDB identifer. Then, we use bioservices.pdb.PDB to get the 3D structure in PDB format.

The script above uses PyMOL in a script manner to save the 3D graphical representation of the protein (here below) but you could also use PyMOL in an interactive mode.

_images/pymol.png
BioPython
URL

http://biopython.org/DIST/docs/tutorial/Tutorial.html#chapter:Bio.AlignIO

BioPython provides many tools for IO, algorithms and access to Web services. BioServices provides access to many web services. This example shows how (i) to use BioServices to retrieve FASTA files and (ii) BioPython to play with the sequences.

Note

We assume you have installed BioPython (pip install biopython)

First, let us retrieve two FASTA sequences and save them in 2 files:

from bioservices import UniProt
u = UniProt()
akt1 = u.retrieve("P31749", "fasta")
akt2 = u.retrieve("P31751", "fasta")

fh = open("akt1.fasta", "w")
fh.write(akt1)
fh.close()

fh = open("akt2.fasta", "w")
fh.write(akt2)
fh.close()

Now, on the BioPython side, we read the 2 sequences and introspect them:

>>> from Bio import AlignIO
>>> record1 = SeqIO.read("akt1.fasta", "fasta")
>>> record2 = SeqIO.read("akt2.fasta", "fasta")
>>> record1 += "-"   # this is to have 2 sequences on same length as requested by the following function

>>> alignment = AlignIO.MultipleSeqAlignment([])
>>> alignment.append(record1)
>>> alignment.append(record2)

>>> for record in alignment:
>>>     print(description)
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2

You are ready to play with BioPython multiple alignment tools. Please consult BioPython documentation for more examples.

Galaxy
URL

http://wiki.galaxyproject.org/FrontPage

Date

Aug 2013

Galaxy is an open, web-based platform for accessible, reproducible, and transparent computational biomedical research. It provides worflows and plugins to many web resources.

This tutorial shows how to link bioservices and galaxy. Our tutorial will provide a plugin to Galaxy so that a user can retrieve a FASTA file via BioServices and the wrapping of UniProt Web Services.

We assume that you installed Galaxy on your system via the source code:

hg clone https://bitbucket.org/galaxy/galaxy-dist/
cd galaxy-dist
hg update stable

The tree directory should therefore contains a directory called tools/ and in the main directory, an XML file called conf_tools.py

We will first create a plugin for bioservices. This is done by adding a directory called bioservices in ./tools:

mkdir tools/bioservices

In this directory, we will create two files called uniprot.py that will contain the actual code that calls bioservices and a second XML file that will allows us to design the plugin layout.

Let us start with the plugin. It is very simple since only the UniProt Entry is required. The output will simply be the FASTA file that would have been fetched.

The XML file is:

<tool id="bioservices_uniprot" name="Get FASTA" version="1.1.0">
  <description>from UniProt via Bioservices</description>
  <requirements>
    <requirement type="package">bioservices</requirement>
  </requirements>
  <command interpreter="python">uniprot.py $uniprot_id $output</command>
  <inputs>
    <param name="uniprot_id" type="text" label="UniProt ID" size="40" help="Provide a valid UniProt Entry (e.g. P43403) "/>
  </inputs>
  <outputs>
    <data format="fasta" name="output" />
  </outputs>
  <help>
Fetch a FASTA file using UniProt via BioServices. Simply provide a valid Uniprot Entry (e.g., P43403)
  </help>
</tool>

The python code will take as an input the UniProt ID and create a file that contains the FASTA data:

import sys

def __main__():
    ids = sys.argv[1]
    filename = sys.argv[2]
    # TODO: check the validity and format ? 
    try:
        from  bioservices import UniProt
        u = UniProt(verbose=False)
        u.debugLevel = "ERROR"
    except ImportError:
        print("Could not import bioservoces ? Check that it is installed. Try 'pip install bioservices'")

    try:
        fasta = u.searchUniProtId(ids, "fasta")
    except:
        print("An error occured while fetching the FASTA file from uniprot")

    try:
        fh = open(filename, "w")
        fh.write(fasta)

finally, you need to make Galaxy aware of this new plugin. this is done in the file called conf_tool.xml. Add bioservices plugin. The beginning of the file should look like:

<?xml version="1.0"?>
 <toolbox>
   <section name="Get Data" id="getext">
     <tool file="bioservices/uniprot.xml"/>
     <tool file="data_source/upload.xml"/>
...

Once done. start you galaxy server. The following image show the outcome: in the left hand side, you can select the bioservices plugin. Then, in the center, you can enter a uniprot entry. Press the execute button and the new file should appear in the right hand side. From there you can use Galaxy other tools to analyse the file.

_images/galaxy.png

This example shows that it is possible to link Galaxy and BioServices to access to various Web Services that are available through Bioservices.

Developer Guide

Naming convention

To add a web services in BioServices, decide on a name for the python module. By convention we have the module name in lower case. Internally, class uses standard Python convention (Upper case for first letter).

The module name (e.g. uniprot) should be use to name the module (uniprot.py).

It will also be used to add a test or the continuous integration

Creating a service class (REST case)

You can test directly a SOAP/WSDL or REST service in a few lines. For instance, to access to the biomart REST service, type:

>>> s = REST("BioMart" ,"http://www.biomart.org/biomart/martservice")

The first parameter is compulsary but can be any word. You can retrieve the base URL by typing:

>>> s.url
'http://www.biomart.org/biomart/martservice'

and then send a request to retrieve registry information for instance (see www.biomart.org.martservice.html for valid request:

>>> s.http_get("?type=registry")
<bioservices.xmltools.easyXML at 0x3b7a4d0>

The request method available from RESTService class concatenates the url and the parameter provided so it request the “http://www.biomart.org.biomart/martservice” URL.

As a developer, you should ease the life of the user by wrapping up the previous commands. An example of a BioMart class with a unique method dedicated to the registry would look like:

>>> class BioMart(REST):
...    def __init__(self):
...        url = "http://www.biomart.org/biomart/martservice"
...        super(BioMart, self).__init__("BioMart", url=url)
...    def registry(self):
...        ret = self.request("?type=registry")
...        return ret

and you would use it as follows:

>>> s = BioMart()
>>> s.registry()
<bioservices.xmltools.easyXML at 0x3b7a4d0>
Creating a service class (WSDL case)

If a web service interface is not provided within bioservices, you can still easily access its functionalities. As an example, let us look at the Ontology Lookup service, which provides a WSDL service. In order to easily access this service, use the WSDLService class as follows:

>>> from bioservices import WSDLService
>>> ols = WSDLService("OLS", "http://www.ebi.ac.uk/ontology-lookup/OntologyQuery.wsdl")

You can now see which methods are available:

>>> ols.wsdl_methods

and call one (getVersion) using the bioservices.services.WSDLService.serv():

>>> ols.serv.getVersion()

You can then look at something more complex and extract relevant information:

>>> [x.value for x in ols.serv.getOntologyNames()[0]]

Of course, you can add new methods to ease the access to any functionalities:

>>> ols.getOnlogyNames() # returns the values

Similarly to the previous case using REST, you can wrap this example into a proper class.

Others

When wrapper a WSDL services, it may be difficult to know what parameters to provide if the API doc is not clear. This can be known as follows using the suds factory. In this previous examples, we could use:

>>> ols.suds.factory.resolver.find('getTermById')
<Element:0xa848b50 name="getTermById" />

For eutils, this was more difficult:

m1 = list(e.suds.wsdl.services[0].ports[0].methods.values())[2]
m1.soap.input.body.parts[0]
the service is in m1.soap.input.body.parts[0] check for the element in the
root attribute
suds and client auth

http://stackoverflow.com/questions/6277027/suds-over-https-with-cert

How to include tests ?

We use pytest. There are many web services included in BioServices. Consequently there are many tests. It is common to have failed tests on Travis and the continuous integration.

Some tests are known to be long or failing from time to time (e.g. service is down).

When a test is known to fail sometimes, we can add this decorator:

@pytest.mark.flaky(max_runs=3, min_passes=1)

On travis we allows 8 failures.

For long tests, we allows 60s at most. You can mark a tests if you knw it will fail on travis (e.g. too long):

pytest.mark.xfail

Finally, we skip some tests for some conditions:

skiptravis = pytest.mark.skipif( "TRAVIS_PYTHON_VERSION" in os.environ,
  reason="On travis")
@skiptravis
def test():
    ...
Continuous integration
  1. add a test in ./test/webservices/test_**yourmodule**.py

2. add a continous integration file named after yourmodule.yml. See example in .github/workflows/template.txt and replace __name__ by your module name

NoteBooks

ipython notebook can be downloaded from this section. You can either see the results via nbviewer, or download and run them yourself. To do so, download the notebook and open a shell where is saved the file. Type:

ipython notebook

You should see the notebook name. Click on it and you are ready to try. Cels can be executed by typing CTRL+enter

UniProt

Here is a ipython notebook dedicated to UniProt, which can be downloaded notebooks/UniProt.ipynb or view its results on uniprot nbviewer

BioModels

Here is a ipython notebook dedicated to BioModels, which can be downloaded notebooks/BioModels.ipynb or view its results on biomodels nbviewer

ChEMBL

Here is a ipython notebook dedicated to ChEMBL, which can be downloaded notebooks/ChEMBL.ipynb or view its results on chembl nbviewer

Entrez/Eutils

Here is a ipython notebook dedicated to EUtils, which can be downloaded notebooks/Entrez_EUtils.ipynb or view its results on eutil nbviewer

KEGG

Here is a ipython notebook dedicated to KEGG, which can be downloaded notebooks/KEGG.ipynb or view its results on kegg nbviewer

MUSCLE

Here is a ipython notebook dedicated to MUSCLE, which can be downloaded notebooks/MUSCLE.ipynb or view its results on muscle nbviewer

NCBIBlast

Here is a ipython notebook dedicated to NCBIblast, which can be downloaded notebooks/NCBIBlast.ipynb or view its results on ncbiblast nbviewer

WikiPathway

Here is a ipython notebook dedicated to WikiPathway, which can be downloaded notebooks/WikiPathway.ipynb or view its results on wikipathway nbviewer

Gene Mapping

Here is a ipython notebook dedicated to Gene Mapping, which can be downloaded notebooks/Gene_Mapping.ipynb or view its results on gene mapping nbviewer

BioMart

Here is a ipython notebook dedicated to BioMart, which can be downloaded notebooks/BioMart or view its results on chembl biomiart

Ensembl

Here is a ipython notebook dedicated to Ensembl, which can be downloaded notebooks/Ensembl.ipynb or view its results on ensembl nbviewer

Utilities

Service module (REST or WSDL)

Modules with common tools to access web resources

exception BioServicesError(value)[source]
class REST(name, url=None, verbose=True, cache=False, requests_per_sec=3, proxies=[], cert=None, url_defined_later=False)[source]

The ideas (sync/async) and code using requests were inspired from the chembl python wrapper but significantly changed.

Get one value:

>>> from bioservices import REST
>>> s = REST("test", "https://www.ebi.ac.uk/chemblws")
>>> res = s.get_one("targets/CHEMBL2476.json", "json")
>>> res['organism']
u'Homo sapiens'

The caching has two major interests. First one is that it speed up requests if you repeat requests.

>>> s = REST("test", "https://www.ebi.ac.uk/chemblws")
>>> s.CACHING = True
>>> # requests will be stored in a local sqlite database
>>> s.get_one("targets/CHEMBL2476")
>>> # Disconnect your wiki and any network connections.
>>> # Without caching you cannot fetch any requests but with
>>> # the CACHING on, you can retrieve previous requests:
>>> s.get_one("targets/CHEMBL2476")

Advantages of requests over urllib

requests length is not limited to 2000 characters http://www.g-loaded.eu/2008/10/24/maximum-url-length/

There is no need for authentication if the web services available in bioservices except for a few exception. In such case, the username and password are to be provided with the method call. However, in the future if a services requires authentication, one can set the attribute authentication to a tuple:

s = REST()
s.authentication = ('user', 'pass')

Note about headers and content type. The Accept header is used by HTTP clients to tell the server what content types they will accept. The server will then send back a response, which will include a Content-Type header telling the client what the content type of the returned content actually is. When using the get__headers(), you can see the User-Agent, the Accept and Content-Type keys. So, here the HTTP requests also contain Content-Type headers. In POST or PUT requests the client is actually sendingdata to the server as part of the request, and the Content-Type header tells the server what the data actually is For a POST request resulting from an HTML form submission, the Content-Type of the request should be one of the standard form content types: application/x-www-form-urlencoded (default, older, simpler) or multipart/form-data (newer, adds support for file uploads)

Constructor

Parameters
  • name (str) – a name for this service

  • url (str) – its URL

  • verbose (bool) – prints informative messages if True (default is True)

  • requests_per_sec – maximum number of requests per seconds are restricted to 3. You can change that value. If you reach the limit, an error is raise. The reason for this limitation is that some services (e.g.., NCBI) may black list you IP. If you need or can do more (e.g., ChEMBL does not seem to have restrictions), change the value. You can also have several instance but again, if you send too many requests at the same, your future requests may be retricted. Currently implemented for REST only

All instances have an attribute called logging that is an instanceof the logging module. It can be used to print information, warning, error messages:

self.logging.info("informative message")
self.logging.warning("warning message")
self.logging.error("error message")

The attribute debugLevel can be used to set the behaviour of the logging messages. If the argument verbose is True, the debugLebel is set to INFO. If verbose if False, the debugLevel is set to WARNING. However, you can use the debugLevel attribute to change it to one of DEBUG, INFO, WARNING, ERROR, CRITICAL. debugLevel=WARNING means that only WARNING, ERROR and CRITICAL messages are shown.

property TIMEOUT
clear_cache()[source]
content_types = {'bed': 'text/x-bed', 'default': 'application/x-www-form-urlencoded', 'fasta': 'text/x-fasta', 'gff3': 'text/x-gff3', 'gif': 'image/gif', 'jpeg': 'image/jpg', 'jpg': 'image/jpg', 'json': 'application/json', 'jsonp': 'text/javascript', 'nh': 'text/x-nh', 'phylip': 'text/x-phyloxml+xml', 'phyloxml': 'text/x-phyloxml+xml', 'png': 'image/png', 'seqxml': 'text/x-seqxml+xml', 'svg': 'image/svg', 'svg+xml': 'image/svg+xml', 'text': 'text/plain', 'txt': 'text/plain', 'xml': 'application/xml', 'yaml': 'text/x-yaml'}
debug_message()[source]
delete_cache()[source]
delete_one(query, frmt='json', **kargs)[source]
getUserAgent()[source]
get_async(keys, frmt='json', params={}, **kargs)[source]
get_headers(content='default')[source]
Parameters

content (str) – set to default that is application/x-www-form-urlencoded so that it has the same behaviour as urllib2 (Sept 2014)

get_one(query=None, frmt='json', params={}, **kargs)[source]

if query starts with http:// do not use self.url

get_sync(keys, frmt='json', **kargs)[source]
http_delete(query, params=None, frmt='xml', headers=None, **kargs)[source]
http_get(query, frmt='json', params={}, **kargs)[source]
  • query is the suffix that will be appended to the main url attribute.

  • query is either a string or a list of strings.

  • if list is larger than ASYNC_THRESHOLD, use asynchronous call.

http_post(query, params=None, data=None, frmt='xml', headers=None, files=None, content=None, **kargs)[source]
post_one(query=None, frmt='json', **kargs)[source]
property session
class Service(name, url=None, verbose=True, requests_per_sec=10, url_defined_later=False)[source]

Base class for WSDL and REST classes

See also

REST, WSDLService

Constructor

Parameters
  • name (str) – a name for this service

  • url (str) – its URL

  • verbose (bool) – prints informative messages if True (default is True)

  • requests_per_sec – maximum number of requests per seconds are restricted to 3. You can change that value. If you reach the limit, an error is raise. The reason for this limitation is that some services (e.g.., NCBI) may black list you IP. If you need or can do more (e.g., ChEMBL does not seem to have restrictions), change the value. You can also have several instance but again, if you send too many requests at the same, your future requests may be retricted. Currently implemented for REST only

All instances have an attribute called logging that is an instanceof the logging module. It can be used to print information, warning, error messages:

self.logging.info("informative message")
self.logging.warning("warning message")
self.logging.error("error message")

The attribute debugLevel can be used to set the behaviour of the logging messages. If the argument verbose is True, the debugLebel is set to INFO. If verbose if False, the debugLevel is set to WARNING. However, you can use the debugLevel attribute to change it to one of DEBUG, INFO, WARNING, ERROR, CRITICAL. debugLevel=WARNING means that only WARNING, ERROR and CRITICAL messages are shown.

property CACHING
easyXML(res)[source]
Use this method to convert a XML document into an

easyXML object

The easyXML object provides utilities to ease access to the XML tag/attributes.

Here is a simple example starting from the following XML

>>> from bioservices import *
>>> doc = "<xml> <id>1</id> <id>2</id> </xml>"
>>> s = Service("name")
>>> res = s.easyXML(doc)
>>> res.findAll("id")
[<id>1</id>, <id>2</id>]
property easyXMLConversion

If True, xml output from a request are converted to easyXML object (Default behaviour).

on_web(url)[source]

Open a URL into a browser

pubmed(Id)[source]

Open a pubmed Id into a browser tab

Parameters

Id – a valid pubmed Id in string or integer format.

The URL is a concatenation of the pubmed URL http://www.ncbi.nlm.nih.gov/pubmed/ and the provided Id.

response_codes = {200: 'OK', 201: 'Created', 400: 'Bad Request. There is a problem with your input', 404: 'Not found. The resource you requests does not exist', 405: 'Method not allowed', 406: 'Not Acceptable. Usually headers issue', 410: 'Gone. The resource you requested was removed.', 415: 'Unsupported Media Type', 500: 'Internal server error. Most likely a temporary problem', 503: 'Service not available. The server is being updated, try again later'}

some useful response codes

save_str_to_image(data, filename)[source]

Save string object into a file converting into binary

property url

URL of this service

class WSDLService(name, url, verbose=True, cache=False)[source]

Class dedicated to the web services based on WSDL/SOAP protocol.

See also

RESTService, Service

Constructor

Parameters
  • name (str) – a name e.g. Kegg, Reactome, …

  • url (str) – the URL of the WSDL service

  • verbose (bool) – prints informative messages

The serv give access to all WSDL functionalities of the service.

The methods is an alias to self.serv.methods and returns the list of functionalities.

property TIMEOUT
wsdl_create_factory(name, **kargs)[source]
property wsdl_methods

returns methods available in the WSDL service

wsdl_methods_info()[source]
xmltools module

This module includes common tools to manipulate XML files

class easyXML(data, encoding='utf-8')[source]

class to ease the introspection of XML documents.

This class uses the standard xml module as well as the package BeautifulSoup to help introspecting the XML documents.

>>> from bioservices import *
>>> n = ncbiblast.NCBIblast()
>>> res = n.getParameters() # res is an instance of easyXML
>>> # You can retreive XML from this instance of easyXML and print the content
>>> # in a more human-readable way.
>>> res.soup.findAll('id') # a Beautifulsoup instance is available
>>> res.root # and the root using xml.etree.ElementTree

There is a getitem so you can type:

res['id']

which is equivalent to:

res.soup.findAll('id')

There is also aliases findAll and prettify.

Constructor

Parameters
  • data – an XML document format

  • fixing_unicode – use only with HGNC service to fix issue with the XML returned by that particular service. No need to use otherwise. See HGNC documentation for details.

  • encoding – default is utf-8 used. Used to fix the HGNC XML only.

The data parameter must be a string containing the XML document. If you have an URL instead, use readXML

getchildren()[source]

returns all children of the root XML document

This is just an alias to self.soup.getchildren()

property soup

Returns the beautiful soup instance

class readXML(url, encoding='utf-8')[source]

Read XML and converts to beautifulsoup data structure

easyXML accepts as input a string. This class accepts a filename instead inherits from easyXML

See also

easyXML

Constructor

Parameters
  • data – an XML document format

  • fixing_unicode – use only with HGNC service to fix issue with the XML returned by that particular service. No need to use otherwise. See HGNC documentation for details.

  • encoding – default is utf-8 used. Used to fix the HGNC XML only.

The data parameter must be a string containing the XML document. If you have an URL instead, use readXML

Services

ArrayExpress
Biocontainers

Interface to biocontainer

What is biocontainers

URL

https://biocontainers.pro/

Citation

BioContainers is an open-source project that aims to create, store, and distribute bioinformatics software containers and packages.

—From biocontainers (about), Jan 2021

class Biocontainers(verbose=True, cache=False)[source]

Interface to Biocontainers service

>>> from bioservics import Biocontainers
>>> b = Biocontainers()
>>> b.get_tools()

Constructor

Parameters

verbose – set to False to prevent informative messages

get_stats()[source]

Returns some stats about numer of versions and tools

get_tools(limit=20000)[source]

Returns all available tools.

get_versions_one_tool(tool)[source]

Returns all versions of a given tool.

BiGG

Interface to the BiGG Models API Service

What is BiGG Models?

URL

http://bigg.ucsd.edu

REST

http://bigg.ucsd.edu/api/v2

“BiGG Models is a knowledgebase of genome-scale metabolic network reconstructions. BiGG Models integrates more than 70 published genome-scale metabolic networks into a single database with a set of standardized identifiers called BiGG IDs. Genes in the BiGG models are mapped to NCBI genome annotations, and metabolites are linked to many external databases (KEGG, PubChem, and many more).”

—BiGG Models Home Page, March 10, 2020.

class BiGG(verbose=False, cache=False)[source]

Interface to the BiGG Models <http://bigg.ucsd.edu/> API Service.

>>> from bioservices import BiGG
>>> bigg = BiGG()
>>> bigg.search("e coli", "models")
[{'bigg_id': 'e_coli_core',
  'gene_count': 137,
  'reaction_count': 95,
  'organism': 'Escherichia coli str. K-12 substr. MG1655',
  'metabolite_count': 72},
  ...
]
download(model_id, format_='json', gzip=True, target=None)[source]
genes(model_id, ids=None)[source]
metabolites(model_id=None, ids=None)[source]
property models
reactions(model_id=None, ids=None)[source]
search(query, type_)[source]
property version
BioDBnet

This module provides a class BioDBNet to access to BioDBNet WS.

What is BioDBNet ?

URL

http://biodbnet.abcc.ncifcrf.gov/

Service

http://biodbnet.abcc.ncifcrf.gov/webServices

Citations

Mudunuri,U., Che,A., Yi,M. and Stephens,R.M. (2009) bioDBnet: the biological database network. Bioinformatics, 25, 555-556

“BioDBNet Database is a repository hosting computational models of biological systems. A large number of the provided models are published in the peer-reviewed literature and manually curated. This resource allows biologists to store, search and retrieve mathematical models. In addition, those models can be used to generate sub-models, can be simulated online, and can be converted between different representational formats. “

—From BioDBNet website, Dec. 2012

New in version 1.2.3.

Section author: Thomas Cokelaer, Feb 2014

class BioDBNet(verbose=True, cache=False)[source]

Interface to the BioDBNet service

>>> from bioservices import *
>>> s = BioDBNet()

Most of the BioDBNet WSDL are available. There are functions added to the original interface such as extra_getReactomeIds().

Use db2db() to convert from 1 database to some databases. Use dbReport() to get the convertion from one database to all databases.

Constructor

Parameters

verbose (bool) –

db2db(input_db, output_db, input_values, taxon=9606)[source]

Retrieves models associated to the provided Taxonomy text.

Parameters
  • input_db – input database.

  • output_db – list of databases to map to.

  • input_values – list of identifiers to map to the output databases

Returns

dataframe where index correspond to the input database identifiers. The columns contains the identifiers for each output database (see example here below).

>>> from bioservices import BioDBNet
>>> input_db = 'Ensembl Gene ID'
>>> output_db = ['Gene Symbol']
>>> input_values = ['ENSG00000121410', 'ENSG00000171428']
>>> df = s.db2db(input_db, output_db, input_values, 9606)
                Gene Symbol
Ensembl Gene ID
ENSG00000121410        A1BG
ENSG00000171428        NAT1
dbFind(output_db, input_values, taxon='9606')[source]

dbFind method

dbFind can be used when you do not know the actual type of your identifiers or when you have a mixture of different types of identifiers. The tool finds the identifier type and converts them into the selected output if the identifiers are within the network.

Parameters
  • output_db (str) – valid database name

  • input_values (list) – list of identifiers to look for

Returns

a dataframe with index set to the input values.

>>> b.dbFind("Gene ID", ["ZMYM6_HUMAN", "NP_710159", "ENSP00000305919"])
                Gene ID                Input Type
InputValue
ZMYM6_HUMAN        9204        UniProt Entry Name
NP_710159        203100  RefSeq Protein Accession
ENSP00000305919  203100        Ensembl Protein ID
dbOrtho(input_db, output_db, input_values, input_taxon, output_taxon)[source]

Convert identifiers from one species to identifiers of a different species

Parameters
  • input_db – input database

  • output_db – output database

  • input_values – list of identifiers to retrieve

  • input_taxon – input taxon

  • output_taxon – output taxon

Returns

dataframe where index correspond to the input database identifiers. The columns contains the identifiers for each output database (see example here below)

>>> df = b.dbOrtho("Gene Symbol", "Gene ID", ["MYC", "MTOR", "A1BG"],
...                    input_taxon=9606, output_taxon=10090)
     Gene ID InputValue
0   17869        MYC
1   56717       MTOR
2  117586       A1BG
dbReport(input_db, input_values, taxon=9606)[source]

Same as db2db() but returns results for all possible outputs.

Parameters
  • input_db – input database

  • input_values – list of identifiers to retrieve

Returns

dataframe where index correspond to the input database identifiers. The columns contains the identifiers for each output database (see example here below)

df = s.dbReport("Ensembl Gene ID", ['ENSG00000121410', 'ENSG00000171428'])
dbWalk(db_path, input_values, taxon=9606)[source]

Walk through biological database network

dbWalk is a form of database to database conversion where the user has complete control on the path to follow while doing the conversion. When a input/node is added to the path the input selection gets updated with all the nodes that it can access directly.

Parameters
  • db_path – path to follow in the databases

  • input_values – list of identifiers

Returns

a dataframe with columns corresponding to the path nodes

A typical example is to get the Ensembl mouse homologs for Ensembl Gene ID’s from human. This conversion is not possible through db2db() as Homologene does not have Ensembl ID’s and the input and output nodes to acheive this would both be ‘Ensembl Gene ID’. It can however be run by using dbWalk as follows. Add Ensembl Gene ID to the path, then add Gene Id, Homolog - Mouse Gene ID and Ensebml Gene ID to complete the path.

db_path = "Ensembl Gene ID->Gene ID->Homolog - Mouse Gene ID->Ensembl Gene ID"
s.dbWalk(db_path, ["ENSG00000175899"])

Todo

check validity of the path

getDirectOutputsForInput(input_db)[source]

Gets all the direct output nodes for a given input node

Gets all the direct output nodes for a given input node Outputs reachable by single edge connection in the bioDBnet graph.

b.getDirectOutputsForInput("genesymbol")
b.getDirectOutputsForInput("Gene Symbol")
b.getDirectOutputsForInput("pdbid")
b.getDirectOutputsForInput("PDB ID")
getInputs()[source]

Return list of possible input database

s.getInputs()
getOutputsForInput(input_db)[source]

Return list of possible output database for a given input database

s.getOutputsForInput("UniProt Accession")
BioGrid

This module provides a class BioGrid.

What is BioGrid ?

URL

http://thebiogrid.org/

Service

Via the PSICQUIC class

BioGRID is an online interaction repository with data compiled through comprehensive curation efforts. Our current index is version 3.2.97 and searches 37,954 publications for 638,453 raw protein and genetic interactions from major model organism species. All interaction data are freely provided through our search index and available via download in a wide variety of standardized formats.

—From BioGrid website, Feb. 2013

class BioGRID(query=None, taxId=None, exP=None)[source]

Interface to BioGRID.

>>> from bioservices import BioGRID
>>> b = BioGRID(query=["map2k4","akt1"],taxId = "9606")
>>> interactors = b.biogrid.interactors

Examples:

>>> from bioservices import BioGRID
>>> b = BioGRID(query=["mtor","akt1"],taxId="9606",exP="two hybrid")
>>> b.biogrid.interactors

One can also query an entire organism, by using the taxid as the query:

>>> b = BioGRID(query="6239")
BioMart

This module provides a class BioModels that allows an easy access to all the BioModel service.

What is BioMart ?

URL

http://www.biomart.org/

REST

http://www.biomart.org/martservice.html

The BioMart project provides free software and data services to the international scientific community in order to foster scientific collaboration and facilitate the scientific discovery process. The project adheres to the open source philosophy that promotes collaboration and code reuse.

—from BioMart March 2013

Note

SOAP and REST are available. We use REST for the wrapping.

class BioMart(host=None, verbose=False, cache=False, secure=False)[source]

Interface to the BioMart service

BioMart is made of different views. Each view correspond to a specific MART. For instance the UniProt service has a BioMart view.

The registry can help to find the different services available through BioMart.

>>> from bioservices import *
>>> s = BioMart()
>>> ret = s.registry() # to get information about existing services

The registry is a list of dictionaries. Some aliases are available to get all the names or databases:

>>> s.names      # alias to list of valid service names from registry
>>> "unimart" in s.names
True

Once you selected a view, you will want to select a database associated with this view and then a dataset. The datasets can be retrieved as follows:

>>> s.datasets("prod-intermart_1")  # retrieve datasets available for this mart

The main issue is how to figure out the database name (here prod-intermart_1) ? Indeed, from the web site, what you see is the displayName and you must introspect the registry to get this information. In BioServices, we provide the lookfor() method to help you. For instance, to retrieve the database name of interpro, type:

>>> s = BioMart(verbose=False)
>>> s.lookfor("interpro")
Candidate:
     database: intermart_1
    MART name: prod-intermart_1
  displayName: INTERPRO (EBI UK)
        hosts: www.ebi.ac.uk

The display name (INTERPRO) correspond to the MART name prod-intermart_1. Let us you it to retrieve the datasets:

>>> s.datasets("prod-intermart_1")
['protein', 'entry', 'uniparc']

Now that we have the dataset names, we can select one and build a query. Queries are XML that contains the dataset name, some attributes and filters. The dataset name is one of the element returned by the datasets method. Let us suppose that we want to query protein, we need to add this dataset to the query:

>>> s.add_dataset_to_xml("protein")

Then, you can add attributes (one of the keys of the dictionary returned by attributes(“protein”):

>>> s.add_attribute_to_xml("protein_accession")

Optional filters can be used:

>>> s.add_filter_to_xml("protein_length_greater_than", 1000)

Finally, you can retrieve the XML query:

>>> xml_query = s.get_xml()

and send the request to biomart:

>>> res = s.query(xml_query)
>>> len(res)
12801
# print the first 10 accession numbers
>>> res = res.split("\n")
>>> for x in res[0:10]: print(x)
['P18656',
 'Q81998',
 'O09585',
 'O77624',
 'Q9R3A1',
 'E7QZH5',
 'O46454',
 'Q9T3F4',
 'Q9TCA3',
 'P72759']

REACTOME example:

s.lookfor("reactome")
s.datasets("REACTOME")
['interaction', 'complex', 'reaction', 'pathway']

s.new_query()
s.add_dataset_to_xml("pathway")
s.add_filter_to_xml("species_selection", "Homo sapiens")
s.add_attribute_to_xml("pathway_db_id")
s.add_attribute_to_xml("_displayname")
xmlq = s.biomartQuery.get_xml()
res = s.query(xmlq)

Note

the biomart sevice is slow (in my experience, 2013-2014) so please be patient…

Constructor

URL required to use biomart change quite often. Experience has shown that BioMart class in Bioservices may fail. This is not a bioservices issue but due to API changes on server side.

For that reason the host is not filled anymore and one must set it manually.

Let us take the example of the ensembl biomart. The host is

www.ensembl.org

Note that there is no prefix http and that the actual URL looked for internally is http://www.ensembl.org/biomart/martview

(It used to be martservice in 2012-2016)

Another reason to not set any default host is that servers may be busy or take lots of time to initialise (if many MARTS are available). Usually, one knows which MART to look at, in which case you may want to use a specific host (e.g., www.ensembl.org) that will speed up significantly the initialisation time.

Parameters

host (str) – a valid host (e.g. “www.ensembl.org”, gramene.org)

List of databases are available in this webpage http://www.biomart.org/community.html

add_attribute_to_xml(name, dataset=None)[source]
add_dataset_to_xml(dataset)[source]
add_filter_to_xml(name, value, dataset=None)[source]
attributes(dataset)[source]

to retrieve attributes available for a dataset:

Parameters

dataset (str) – e.g. oanatinus_gene_ensembl

configuration(dataset)[source]

to retrieve configuration available for a dataset:

Parameters

dataset (str) – e.g. oanatinus_gene_ensembl

create_attribute(name, dataset=None)[source]
create_filter(name, value, dataset=None)[source]
custom_query(**args)[source]
property databases

list of valid datasets

datasets(mart, raw=False)[source]

to retrieve datasets available for a mart:

Parameters

mart (str) – e.g. ensembl. see names for a list of valid MART names the mart is the database. see lookfor method or databases attributes

>>> s = BioMart(verbose=False)
>>> s.datasets("prod-intermart_1")
['protein', 'entry', 'uniparc']
property displayNames

list of valid datasets

filters(dataset)[source]

to retrieve filters available for a dataset:

Parameters

dataset (str) – e.g. oanatinus_gene_ensembl

>>> s.filters("uniprot").split("\n")[1].split("\t")
>>> s.filters("pathway")["species_selection"]
[Arabidopsis thaliana,Bos taurus,Caenorhabditis elegans,Canis familiaris,Danio
rerio,Dictyostelium discoideum,Drosophila melanogaster,Escherichia coli,Gallus
gallus,Homo sapiens,Mus musculus,Mycobacterium tuberculosis,Oryza
sativa,Plasmodium falciparum,Rattus norvegicus,Saccharomyces
cerevisiae,Schizosaccharomyces pombe,Staphylococcus aureus N315,Sus
scrofa,Taeniopygia guttata ,Xenopus tropicalis]
get_datasets(mart)[source]

Retrieve datasets with description

get_xml()[source]
property host
property hosts

list of valid hosts

lookfor(pattern, verbose=True)[source]
property marts

list of marts

property names

list of valid datasets

new_query()[source]
query(xmlq)[source]

Send a query to biomart

The query must be formatted in a XML format which looks like ( example from https://gist.github.com/keithshep/7776579):

<?xml version="1.0" encoding="UTF-8"?>
    <!DOCTYPE Query>
        <Query virtualSchemaName="default" formatter="CSV" header="0" uniqueRows="0" count="" datasetConfigVersion="0.6">
        <Dataset name="mmusculus_gene_ensembl" interface="default">
        <Filter name="ensembl_gene_id" value="ENSMUSG00000086981"/>
        <Attribute name="ensembl_gene_id"/>
        <Attribute name="ensembl_transcript_id"/>
        <Attribute name="transcript_start"/>
        <Attribute name="transcript_end"/>
        <Attribute name="exon_chrom_start"/>
        <Attribute name="exon_chrom_end"/>
        </Dataset>
        </Query>

Warning

the input XML must be valid. THere is no validation made in thiss method.

registry()[source]

to retrieve registry information

the XML contains list of children called MartURLLocation made of attributes. We parse the xml to return a list of dictionary. each dictionary correspond to one MART.

aliases to some keys are provided: names, databases, displayNames

property valid_attributes

list of valid datasets

version(mart)[source]

Returns version of a mart

Parameters

mart (str) – e.g. ensembl

BioModels

This module provides a class BioModels to access to BioModels WS.

What is BioModels ?

URL

http://www.ebi.ac.uk/biomodels/

Service

http://www.ebi.ac.uk/biomodels

Citations

please visit https://www.ebi.ac.uk/biomodels/citation for details

“BioModels is a repository of mathematical models of biological and biomedical systems. It hosts a vast selection of existing literature-based physiologically and pharmaceutically relevant mechanistic models in standard formats. Our mission is to provide the systems modelling community with reproducible, high-quality, freely-accessible models published in the scientific literature.”

—From BioModels website, March 2020

class BioModels(verbose=True)[source]

Interface to the BioModels service

from bioservices import BioModels
bm = BioModels()
model = bm.get_model('BIOMD0000000299')

Previous API had several functions such as getAuthorsByModelId. This is easy to mimic with the new API:

bm = BioModels()
models = bm.get_all_models()
[x['submitter'] for x in res if x[] == "MODEL1204280003"][0]

This is also true for getDateLastModifByModelId and getModelNameById if one use the field lastModified or name. There was the ability to search for models based on their CHEBI identifiers, which is not supported anymore; this concerns functions getModelsIdByChEBI, getModelsIdByChEBIId, getSimpleModelsByChEBIIds, getSimpleModelsRelatedWithChEBI. For other searches related to Reactome, Uniprot identifiers or GO terms, the search() method should work:

bm.search("P10113")
bm.search("REACT_33")
bm.search("GO:0006919")

constructor

Parameters

verbose (bool) –

get_all_models(chunk=100)[source]

Return all models

get_model(model_id, frmt='json')[source]

Fetch information about a given model at a particular revision.

get_model_download(model_id, filename=None, output_filename=None)[source]

Download a particular file associated with a given model or all its files as a COMBINE archive.

Parameters
  • model_id – a valid BioModels identifier

  • filename (str) – this is the requested filename to be found in the model

  • output_filename (str) – if you request a different output filename, use this parameter

  • frmt – format of the output (json, xml, html)

Returns

nothing. This function save the model into a ZIP file called after the model identifier. If parameter filename is specified, then the output file is the requested filename (if found)

bm.get_model_download("BIOMD0000000100", filename="BIOMD0000000100.png")
bm.get_model_download("BIOMD0000000100")

This function can retrieve all files in a ZIP archive or a single image. In the example below, we retrieve the PNG and plot it using matplotlib. Using your favorite image viewver, you should get a better resolution. Or just download the SVG version of the model.

from bioservices import BioModels
bm = BioModels()
from easydev import TempFile
with TempFile(suffix=".png") as fout:
    bm.get_model_download("BIOMD0000000100",
            filename="BIOMD0000000100.png",
            output_filename=fout.name)
    from pylab import imshow, imread
    imshow(imread(fout.name), aspect="auto")

(Source code, png, hires.png, pdf)

_images/references-1.png
get_model_files(model_id, frmt='json')[source]

Extract metadata information of model files of a particular model

Parameters
  • model_id – a valid BioModels identifier

  • frmt – format of the output (json, xml)

get_p2m_missing(frmt='json')[source]

Retrieve all models in Path2Models that are now only available indirectly, through the representative model for the corresponding genus

Parameters

frmt (str) – the format of the result (xml, csv, json)

Returns

list of model identifiers

get_p2m_representative(model, frmt='json')[source]

Retrieve a representative model in Path2Models

Get the representative model identifier for a given missing model in Path2Models. This endpoint accepts as parameters a mandatory model identifier and an optional response format

Parameters
  • model (str) – The identifier of a model of interest

  • frmt (str) – the format of the result (xml, csv, json)

get_p2m_representatives(models, frmt='json')[source]

Find the replacement accessions for a set of Path2Models entries

Get the representative model identifiers of a set of given missing models in Path2Models. This end point expects a comma-separated list of model identifiers (without any surrounding whitespace) and an optional response format. Examples: BMID000000112902, BMID000000009880, BMID000000027397.

Parameters
  • model (str) – The model identifiers separated by commas, or as a list.

  • frmt (str) – the format of the result (xml, csv, json)

from bioservices import BioModels
bm = BioModels()
bm.get_p2m_representatives("BMID000000112902, BMID000000009880, BMID000000027397")
get_pdgsmm_missing(frmt='json')[source]

Retrieve the identifiers of all PDGSMM entries that are no longer directly accessible

Parameters

frmt (str) – the format of the result (xml, csv, json)

Returns

list of model identifiers

get_pdgsmm_representative(model, frmt='json')[source]

Retrieve a representative model in PDGSMM

Get the representative model identifier for a given missing model in PDGSMM. This endpoint accepts as parameters a mandatory model identifier and an optional response format.

Parameters
  • model (str) – The identifier of a model of interest

  • frmt (str) – the format of the result (xml, csv, json)

get_pdgsmm_representatives(models, frmt='json')[source]

Find the replacement accessions for a set of PDFSSM

Get the representative model identifiers of a set of given missing models in PDGSMM. This end point expects a comma-separated list of model identifiers (without any surrounding whitespace) and an optional response format. Examples: MODEL1707110145,MODEL1707112456,MODEL1707115900.

Parameters
  • model (str) – The model identifiers separated by commas, or as a list.

  • frmt (str) – the format of the result (xml, csv, json)

search(query, offset=None, numResults=None, sort=None, frmt='json')[source]

Search models of interest via keywords.

Examples: PUBMED:”27869123” to search models associated with the PubMed record identified by 27869123.

Parameters
  • query (str) – search query. colon character must be escaped

  • offset (int) – number of items to skip before starting to collect the result set

  • numResults (int) – number of items to return

  • sort (str) – sort criteria in {id-asc, relevance-asc, relevance-desc, first_author-asc, first_author, name-asc, name-desc, publication_year-asc, publication_year-desc}

  • frmt (str) – format of the output (json, xml)

search_download(models, output_filename='models.zip', force=False)[source]

Returns models (XML) corresponding to a list of model identifiers.

Parameters
  • models (str) – list of model identifiers using comma to separate them. Could be a list of string (e.g ‘BIOMD1,BIOMD2’ or [‘BIOMD1’, ‘BIOMD2’]

  • output_filename (str) – file used to save the models. This is a zipped file. If the file exists, you must use the force* parameter

Todo

if no models are found (typos), an error message is printed. if one model is not found, there is no warning or errors. Could be nice to have a warning by introspecting the number of models in the output file

search_parameter(query, start=0, size=10, sort=None, frmt='json')[source]

Search for parameters of a model

Details BioModels Parameters is a resource that facilitates easy search and retrieval of parameter values used in the SBML models stored in the BioModels repository. Users can search for a model entity (e.g. a protein or drug) to retrieve the rate equations describing it; the associated parameter values and the initial concentration from the SBML models in BioModels. Although these data are directly extracted from the curated SBML models, they are not individually curated or validated; rather presented as such in the table below. Hence BioModels Parameters table will only provide a quick overview of available parameter values for guidance and original model should be referred to understand the complete context of the parameter usage.

Parameters
  • query (str) – A query to search against the model parameter values.

  • start (int) – if is the offset of the result set (default 0)

  • size (int) – number of items to display per page

  • sort (str) – model or entity

  • frmt (str) – the format of the result (xml, csv, json)

bm.search_parameter("MAPK", size=100, sort="entity")
ChEBI

This module provides a class ChEBI

What is ChEBI

URL

https://www.ebi.ac.uk/chebi/init.do

WSDL

http://www.ebi.ac.uk/webservices/chebi/2.0/webservice

“The database and ontology of Chemical Entities of Biological Interest

—From ChEBI web page June 2013

class ChEBI(verbose=False)[source]

Interface to ChEBI

>>> from bioservices import *
>>> ch = ChEBI()
>>> res = ch.getCompleteEntity("CHEBI:27732")
>>> res.smiles
CN1C(=O)N(C)c2ncn(C)c2C1=O

Constructor

Parameters

verbose (bool) –

conv(chebiId, target)[source]

Calls getCompleteEntity() and returns the identifier of a given database

Parameters
  • chebiId (str) – a valid ChEBI identifier (string)

  • target – the identifier of the database

Returns

the identifier

>>> ch.conv("CHEBI:10102", "KEGG COMPOUND accession")
['C07484']
getAllOntologyChildrenInPath(chebiId, relationshipType, onlyWithChemicalStructure=False)[source]

Retrieves the ontology children of an entity including the relationship type

Parameters
  • chebiId (str) – a valid ChEBI identifier (string)

  • relationshipType (str) – one of “is a”, “has part”, “has role”, “is conjugate base of”, “is conjugate acid of”, “is tautomer of” “is enantiomer of”, “has functional parent” “has parent hybride” “is substituent group of”

>>> ch.getAllOntologyChildrenInPath("CHEBI:27732", "has part")
getCompleteEntity(chebiId)[source]

Retrieves the complete entity including synonyms, database links and chemical structures, using the ChEBI identifier.

param str chebiId

a valid ChEBI identifier (string)

return

an object containing fields such as mass, names, smiles

>>> from bioservices import *
>>> ch = ChEBI()
>>> res = ch.getCompleteEntity("CHEBI:27732")
>>> res.mass
194.19076

The returned structure is the raw object returned by the API. You can extract names from other sources for instance:

>>> [x[0] for x in res.DatabaseLinks if x[1].startswith("KEGG")]
[C07481, D00528]
>>> [x[0] for x in res.DatabaseLinks if x[1].startswith("ChEMBL")]
[116485]
getCompleteEntityByList(chebiIdList=[])[source]

Given a list of ChEBI accession numbers, retrieve the complete Entities.

The maximum size of this list is 50.

getLiteEntity(search, searchCategory='ALL', maximumResults=200, stars='ALL')[source]

Retrieves list of entities containing the ChEBI ASCII name or identifier

Parameters
  • search – search string or category.

  • searchCategory – filter with category. Can be ALL,

  • maximumResults (int) – (default is 200)

  • stars (str) – filters that can be set to “TWO ONLY”, “ALL”, “THREE ONLY”

The input parameters are a search string and a search category. If the search category is null then it will search under all fields. The search string accepts the wildcard character “*” and also unicode characters. You can get maximum results upto 5000 entries at a time.

>>> ch.getLiteEntity("CHEBI:27732")
[(LiteEntity){
   chebiId = "CHEBI:27732"
   chebiAsciiName = "caffeine"
   searchScore = 4.77
   entityStar = 3
 }]
>>> res = ch.getLiteEntity("caffeine")
>>> res = ch.getLiteEntity("caffeine", maximumResults=10)
>>> len(res)
10
getOntologyChildren(chebiId)[source]

Retrieves the ontology children of an entity including the relationship type

Parameters

chebiId (str) – a valid ChEBI identifier (string)

getOntologyParents(chebiId)[source]

Retrieves the ontology parents of an entity including the relationship type

Parameters

chebiId (str) – a valid ChEBI identifier (string)

getStructureSearch(structure, mode='MOLFILE', structureSearchCategory='SIMILARITY', totalResults=50, tanimotoCutoff=0.25)[source]

Does a substructure, similarity or identity search using a structure.

Parameters
  • structure (str) – the input structure

  • mode (str) – type of input (MOLFILE, SMILES, CML” (note that the API uses type but this is a python keyword)

  • structureSearchCategory (str) – category of the search. Can be “SIMILARITY”, “SUBSTRUCTURE”, “IDENTITY”

  • totalResults (int) – limit the number of results to 50 (default)

  • tanimotoCuoff – limit results to scores higher than this parameter

>>> ch = ChEBI()
>>> smiles = ch.getCompleteEntity("CHEBI:27732").smiles
>>> ch.getStructureSearch(smiles, "SMILES", "SIMILARITY", 3, 0.25)
getUpdatedPolymer(chebiId)[source]

Returns the UpdatedPolymer object

Parameters
  • chebiId (str) –

  • chebiId – a valid ChEBI identifier (string)

Returns

an object with information as described below.

The object contains the updated 2D MolFile structure, GlobalFormula string containing the formulae for each repeating-unit, the GlobalCharge string containing the charge on individual repeating-units and the primary ChEBI ID of the polymer, even if the secondary Identifier was passed to the web-service.

ChEMBL

This module provides a class ChEMBL

What is ChEMBL

URL

https://www.ebi.ac.uk/chembl

REST

https://www.ebi.ac.uk/chembl/api/data

“Using the ChEMBL web service API users can retrieve data from the ChEMBL database in a programmatic fashion. The following list defines the currently supported functionality and defines the expected inputs and outputs of each method.”

—From ChEMBL web page Dec 2012

class ChEMBL(verbose=False, cache=False)[source]

New ChEMBL API bioservices 1.6.0

Resources

ChEMBL database is made of a set of resources. We recommend to look at https://arxiv.org/pdf/1607.00378.pdf

Here we first create an instance and retrieve the first 1000 molecules from the database using the limit parameter.

>>> from bioservices import ChEMBL
>>> c = ChEMBL()
>>> res = c.get_molecule(limit=1000)

The returned objet is a list of 1000 records, each of them being a dictionary. The molecule resource is actually a very large one and one may want to skip some entries. This is possible using the offset parameter as follows:

# Retrieve 1000 molecules skipping the first 50
res = c.get_molecule(limit=1000, offset=50)

If you want to know all resources available and the number of entries in each resources, use:

status = c.get_status_resources()

For instance, you should be able to get the total number of entries in the mechanism resource is about 5,000:

print(status['mechanism'])

To retrieve all entries from the mechanism resource, you can either set limit to a value large enough:

res = c.get_mechanism(limit=1000000)

or simply set it to -1:

res = c.get_mechanism(limit=-1)

All resources methods behaves in the same way.

Those resources methods are: get_activity(), get_assay(), get_atc_class(), get_binding_site(), get_biotherapeutic(), get_cell_line(), get_chembl_id_lookup(), get_compound_record(), get_compound_structural_alert(), get_document(), get_document_similarity(), get_document_term(), get_drug(), get_drug_indication(), get_go_slim(), get_mechanism(), get_metabolism(), get_molecule(), get_molecule_form(), get_protein_class(), get_source(), get_target(), get_target_component(), get_target_prediction(), get_target_relation(), get_tissue().

3 ways of getting items

  1. Retrieve everything:

    c.get_molecule(limit=-1)
    
  2. Retrieve a specific entry:

    c.get_molecule("CHEMBL24")
    
  3. Retrieve a set of entries:

    c.get_molecule(["CHEMBL24","CHEMBL2"])
    

Filtering and Ordering

For ordering the results, we provide a simple method order_by() that allows to sort the dictionary according to values in a specific key.

Any data returned by a resource method (a list of dictionary) can be process through this method:

c = ChEMBL()
data = c.get_drug(limit=100)
ordered_data = c.order_by(data, 'chirality')

If you want to order using a key within a key, for instance order by molecular weight stored in the molecular_properties key, use the double underscore method as follows:

c = ChEMBL()
data = c.get_drug(limit=100)
ordered_data = c.order_by(data, 'molecular_properties__mw_freebase')

For filtering, it is possible to apply search filters to any resources. For example, it is possible to return all ChEMBL targets that contain the term ‘kinase’ in the pref_name attribute:

c.get_target(filters='pref_name__contains=kinase")

The pattern for applying a filter is as follows:

[field]__[filter_type]=[value]

where field has to be found by the user. Simply introspect the content of an item returned by the resource. For instance:

c.get_target(limit=1) # to get one entry

Let us consider the case of the molecule resource. You can retrieve the first 10 molecules using e.g.:

res = c.get_molecule(limit=10)

If you look at the first entry using res[0], you will get about 38 keys. For instance molecule_properties or molecule_chembl_id.

You can filter the molecules to keep only the molecule_chembl_id that match either CHEMBL25 or CHEMBL1000 using:

res = c.get_molecule(filters='molecule_chembl_id__in=CHEMBL25,CHEMBL1000')

For molecule_properties, this is actually a dictionary. For instance, inside the molecule_properties field, you have the molecular weight (mw_freebase). So to apply this filter, you need to use the following code (to keep molecules with molecular weight greater than 300:

res = c.get_molecule(filters='molecule_properties__mw_freebase__gte=300')

Here are the different types of filtering:

Filter Type

Description

exact (iexact)

Exact match with query

contains

wild card search with query

startswith

starts with query

endswith

ends with query

regex

regulqr expression query

gt (gte)

Greater than (or equal)

lt (lte)

Less than (or equal)

range

Within a range of values

in

Appears within list of query values

isnull

Field is null

search

Special type of filter allowing a full text search based on Solr queries.

Several filters can be applied at the same time using a list:

filters = ['molecule_properties__mw_freebase__gte=300']
filters += ['molecule_properties__alogp__gte=3']
res = c.get_molecule(filters)

Use Cases: (inspired from ChEMBL documentation)

Search molecules by synonym:

>>> from bioservices import ChEMBL
>>> c = ChEMBL()
>>> res = c.search_molecule('aspirin')

or SMILE, or InChiKey, or CHEMBLID:

>>> res = c.get_molecule("CC(=O)Oc1ccccc1C(=O)O")
>>> res = c.get_molecule("BSYNRYMUTXBXSQ-UHFFFAOYSA-N")
>>> res = c.get_molecule('CHEMBL25')

Several molecules at the same time can also be retrieved using lists:

>>> res = c.get_molecule(['CHEMBL25', 'CHEMBL2'])

Search target by gene name:

>>> res = c.search_target("GABRB2")
>>> len(res['targets'])
18

or directly in the target synonym field:

>>> res = c.get_target(filters='target_synonym__icontains=GABRB2')

Note

Not sure what is the difference between icontains vs contains. It looks like icontains is more permissive (you get more entries with icontains).

Having a list of molecules ChEMBL IDs in a list, get uniprot accession numbers that map to those compounds:

# First, get some IDs of approved drugs (about 2000 molecules)
c = ChEMBL()
drugs = c.get_approved_drugs()
IDs = [x['molecule_chembl_id'] for x in drugs]

# we jump from compounds to targets through activities
# Here this is a one to many mapping so we initialise a default
# dictionary.
compound2target = defaultdict(set)

filter = "molecule_chembl_id__in={}"
for i in range(0, len(IDs), 50):
    activities = c.get_activity(filter.format(IDs[i:i+50]))
    # get target ChEMBL IDs from activities
    for act in activities:
        compound2target[act['molecule_chembl_id']].add(act['target_chembl_id'])

# What we need is to get targets for all targets found in the previous
# step. For each compound/drug there are hundreds of targets though. And
# we will call the get_target for each list of hundreds targets. This
# will take forever. Instead, because there are *only* 12,000 targets,
# let us download all of them ! This took about 4 minutes on this test but
# if you use the cache, next time it will be much much quicker. This is
# not down at the activities level because there are too many entries

targets = c.get_target(limit=-1)

# identifies all target chembl id to easily retrieve the entry later on
target_names = [target['target_chembl_id'] for target in targets]

# retrieve all uniprot accessions for all targets of each compound
for compound, targs in compounds2targets.items():
    accessions = set()
    for target in targs:
        index = target_names.index(target)
        accessions = accessions.union([comp['accession']
            for comp in targets[index]['target_components']])
    compounds2targets[compound] = accessions

In version 1.6.0 of bioservices, you can simply use:

res = c.compounds2targets(IDs)

Get Target type count for all targets:

import collections
collections.Counter([x['target_type'] for x in targets]

Find compounds similar to given SMILES query with similarity threshold of 85%:

>>> SMILE = "CN(CCCN)c1cccc2ccccc12"
>>> c.get_similarity(SMILE, similarity=70)

Find compounds similar to aspirin (CHEMBL25) with similarity threshold of 70%:

# search for aspirin in all molecules and from first hist
# get the ChEMBL ID
>>> molecules = c.search_molecule("aspirin")['molecules']
>>> chembl_id = molecules[0]['molecule_chembl_id']
# now use the :meth:`get_similarity` given the ID
>>> res = c.get_similarity(chembl_id, similarity=70)

Perform substructure search using SMILES or ChEMBID:

>>> res = c.get_substructure("CN(CCCN)c1cccc2ccccc12")
>>> res = c.get_substructure("CHEMBL25")

Obtain he pChEMBL value for compound:

res = c.get_activity(filters=['pchembl_value__isnull=False',
                              'molecule_chembl_id=CHEMBL25'])

Obtain he pChEMBL value for compound and target:

res = c.get_activity(filters=['pchembl_value__isnull=False',
                              'molecule_chembl_id=CHEMBL25',
                              'target_chembl_id=CHEMBL612545'])

Get all approved drugs:

c.get_approved_drugs(max_phase=4)

Get approved drugs for lung cancer

The ChEMBL API significantly changed in 2018 and the new version of bioservices (1.6.0) had to change the API as well, which has been simplified.

Here below are some correspondances between the previous and the new API.

bioservices before 1.6.0

After 1.6.0

get_compounds_substructure

get_substructure

get_compounds_similar_to_SMILES

get_similarity(SMILE)

get_compounds_by_chemblId(ID)

get_similarity(ID)

get_individual_compounds_by_inChiKey

get_molecule(inchikey)

get_compounds_by_chemblId_form

get_molecule_form

get_compounds_by_chemblId_drug_mechanism

get_mechanism(ID)

get_target_by_chemblId(ID)

get_target(ID)

get_image_of_compounds_by_chemblId

get_image

etc

References
compounds2accession(compounds)[source]

For each compound, identifies the target and corresponding UniProt accession number

This is not part of ChEMBL API

# we recommend to use cache if you use this method regularly
c = Chembl(cache=True)
drugs = c.get_approved_drugs()

# to speed up example
drugs = drugs[0:20]
IDs = [x['molecule_chembl_id] for x in drugs]

c.compounds2accession(IDs)
get_ATC(limit=20, offset=0, filters=None)[source]

WHO ATC Classification for drugs

c.get_atc() c[‘atc’]

Note

get_molecule returns ‘molecules’ and likewise all methods return a dictionary whose key is the plural of the method name. This is quite consistent through the API except for that one because it is an acronym

get_activity(query=None, limit=20, offset=0, filters=None)[source]

Activity values recorded in an Assay

get_approved_drugs(max_phase=4, maxdrugs=1000000)[source]

Return all approved drugs

Parameters

max_phase – 4 by default for approved drugs.

get_assay(query=None, limit=20, offset=0, filters=None)[source]

Assay details as reported in source Document/Dataset

>>> c.get_assay("CHEMBL1217643")
get_binding_site(limit=20, offset=0, filters=None)[source]

Target binding site definition

get_biotherapeutic(limit=20, offset=0, filters=None)[source]

Biotherapeutic molecules, which includes HELM notation and sequence data

get_cell_line(limit=20, offset=0, filters=None)[source]

Cell line information

get_chembl_id_lookup(query=None, limit=20, offset=0, filters=None)[source]

Look up ChEMBL Id entity type

get_compound_record(query=None, limit=20, offset=0, filters=None)[source]

Occurence of a given compound in a spcecific document

get_compound_structural_alert(query=None, limit=20, offset=0, filters=None)[source]

Indicates certain anomaly in compound structure

get_document(query=None, limit=20, offset=0, filters=None)[source]

Document/Dataset from which Assays have been extracted

get_document_similarity(query=None, limit=20, offset=0, filters=None)[source]

Provides documents similar to a given one

get_document_term(query=None, limit=20, offset=0, filters=None)[source]

Provides keywords extracted from a document using the TextRank algorithm

get_drug(query=None, limit=20, offset=0, filters=None)[source]

Approved drugs information, icluding (but not limited to) applicants, patent numbers and research codes

get_drug_indication(query=None, limit=20, offset=0, filters=None)[source]

Joins drugs with diseases providing references to relevant sources

get_go_slim(query=None, limit=20, offset=0, filters=None)[source]

GO slim ontology

get_image(query, dimensions=500, format='png', save=True, view=True, engine='indigo')[source]

Get the image of a given compound in PNG png format.

Parameters
  • query (str) – a valid compound ChEMBLId or a list/tuple of valid compound ChEMBLIds.

  • format – png, svg. json not supported

  • dimensions (int) – size of image in pixels. An integer z (1 \leq z \leq 500)

  • save

  • view (bool) –

  • engine – Defaults to rdkit. can be rdkit or indigo

  • view – show the image if set to True.

Returns

the path (list of paths) used to save the figure (figures) (different from Chembl API)

>>> from pylab import imread, imshow
>>> from bioservices import *
>>> s = ChEMBL(verbose=False)
>>> res = s.get_image(31863)
>>> imshow(imread(res['filenames'][0]))

(Source code)

Todo

ignorecoords option

get_mechanism(query=None, limit=20, offset=0, filters=None)[source]

Mechanism of action information for FDA-approved drugs

get_metabolism(query=None, limit=20, offset=0, filters=None)[source]

Metabolic pathways with references

get_molecule(query=None, limit=20, offset=0, filters=None)[source]

Returns some molecules

Parameters
  • limit – number of molecules to retrieve

  • offset – molecules to ignore before retrieving molecules.

Returns

a dictionary with keys page_meta and molecules.

There are 1,800,000 molecules (Jan 2019). You can only retrieve 1,000 molecule at most using the limit parameter. With a loop you can retrieve molecules in some range.

c.get_molecule('QFFGVLORLPOAEC-SNVBAGLBSA-N')
c.get_molecule("CC(=O)Oc1ccccc1C(=O)O")
get_molecule_form(query=None, limit=20, offset=0, filters=None)[source]

Relationships between molecule parents and salts

>>> s.get_molecule_form("CHEMBL2")['molecule_forms']
[{'is_parent': 'True',
  'molecule_chembl_id': 'CHEMBL2',
  'parent_chembl_id': 'CHEMBL2'},
 {'is_parent': 'False',
  'molecule_chembl_id': 'CHEMBL1558',
  'parent_chembl_id': 'CHEMBL2'},
 {'is_parent': 'False',
  'molecule_chembl_id': 'CHEMBL1347191',
  'parent_chembl_id': 'CHEMBL2'}]
get_organism(query=None, limit=20, offset=0, filters=None)[source]
get_protein_class(query=None, limit=20, offset=0, filters=None)[source]

Protein family classification of TargetComponents

get_similarity(structure, similarity=80, limit=20, offset=0, filters=None)[source]

Molecule similarity search

Parameters
  • structure – provide a valid / existing substructure in SMILE format to look for in all molecules:

  • similarity – must be an integer greater than 70 and less than 100

Returns

list of molecules corresponding to the search

>>> from bioservices import ChEMBL
>>> c = ChEMBL()
>>> res = c.get_similarity("CC(=O)Oc1ccccc1C(=O)O", 80)
>>> res['molecules']

Here are more examples:

# Similarity (80% cut off) search for against ChEMBL using
# aspirin SMILES string
c.get_similarity("CC(=O)Oc1ccccc1C(=O)O") # 80 by default

# Similarity (80% cut off) search for against ChEMBL using
# aspirin CHEMBL_ID
c.get_similarity("CHEMBL25")

# Similarity (80% cut off) search for against ChEMBL
# using aspirin InChI Key
c.get_similarity("BSYNRYMUTXBXSQ-UHFFFAOYSA-N")

The ‘Substructure’ and ‘Similarity’ web service resources allow for the chemical content of ChEMBL to be searched. Similar to the other resources, these search based resources except filtering, paging and ordering arguments. These methods accept SMILES, InChI Key and molecule ChEMBL_ID as arguments and in the case of similarity searches an additional identity cut-off is needed. Some example molecule searches are provided in the table below.

Searching with InChI key is only possible for InChI keys found in the ChEMBL database. The system does not try and convert InChI key to a chemical representation.

get_source(query=None, limit=20, offset=0, filters=None)[source]

Document/Dataset source

get_status()[source]

Return version of the DB and number of entries

Returns the number of entries for activities, compound_records, distinct_compounds (molecule), publications (document), targets, etc…

get_status_resources()[source]

Return number of entries for all resources

Note

not in the ChEMBL API.

Changed in version 1.7.3: (removed target_prediction and document_term)

get_substructure(structure, limit=20, offset=0, filters=None)[source]

Molecule substructure search

Parameters

structure – provide a valid / existing substructure in SMILE format to look for in all molecules:

Returns

list of molecules corresponding to the search

>>> from bioservices import ChEMBL
>>> c = ChEMBL()
>>> res = c.get_substructure("CC(=O)Oc1ccccc1C(=O)O")

Other examples:

# Substructure search for against ChEMBL using aspirin
# SMILES string
c.get_substructure("CC(=O)Oc1ccccc1C(=O)O")

# Substructure search for against ChEMBL using aspirin
# CHEMBL_ID
c.get_substructure("CHEMBL25")

# Substructure search for against ChEMBL using aspirin
# InChIKey
c.get_substructure("BSYNRYMUTXBXSQ-UHFFFAOYSA-N")

The ‘Substructure’ and ‘Similarity’ web service resources allow for the chemical content of ChEMBL to be searched. Similar to the other resources, these search based resources except filtering, paging and ordering arguments. These methods accept SMILES, InChI Key and molecule ChEMBL_ID as arguments and in the case of similarity searches an additional identity cut-off is needed. Some example molecule searches are provided in the table below.

Searching with InChI key is only possible for InChI keys found in the ChEMBL database. The system does not try and convert InChI key to a chemical representation.

get_target(query=None, limit=20, offset=0, filters=None)[source]

Targets (protein and non-protein) defined in Assay

>>> from bioservices import *
>>> s = ChEMBL(verbose=False)
>>> resjson = s.get_targetd('CHEMBL240')
get_target_component(query=None, limit=20, offset=0, filters=None)[source]

Target sequence information (A Target may have 1 or more sequences)

res = c.get_target_component(1)
res['sequence']
get_target_prediction(query=None, limit=20, offset=0, filters=None)[source]

Predictied binding of a molecule to a given biological target

>>> res = c.get_target_prediction(1)
>>> res['molecule_chembl_id']
'CHEMBL2'
get_target_relation(query=None, limit=20, offset=0, filters=None)[source]

Describes relations between targets

>>> c.get_target_relation('CHEMBL261')
{'related_target_chembl_id': 'CHEMBL2095180',
 'relationship': 'SUBSET OF',
 'target_chembl_id': 'CHEMBL261'}
get_tissue(query=None, limit=20, offset=0, filters=None)[source]

Tissue classification

c.get_tissue(filters=[‘pref_name__contains=cervix’])

get_xref_source(query=None, limit=20, offset=0, filters=None)[source]
order_by(data, name, ascending=True)[source]

Ordering data

we use same API as ChEMBL API using the double underscore to indicate a hierarchy in the dictionary. So to access to d[‘a’][‘b’], we use a__b as the input name parameter. We only allows 3 levels e.g., a__b__c

data = c.get_molecules()
data1 = c.order_by(data, 'molecule_chembl_id')
data2 = c.order_by(data, 'molecule_properties__alogp')

Note

the ChEMBL API allows for ordering but we do not use that API. Instead, we provide this generic function.

search_activity(query, limit=20, offset=0)[source]

Activity values recorded in an Assay

search_assay(query, limit=20, offset=0)[source]

Assay details as reported in source document

search_chembl_id_lookup(query, limit=20, offset=0)[source]

Look up ChEMBL Id entity type

search_document(query, limit=20, offset=0)[source]

Document/Dataset from which Assays have been extracted

search_molecule(query, limit=20, offset=0)[source]
search_protein_class(query, limit=20, offset=0)[source]
search_target(query, limit=20, offset=0)[source]

Targets (protein and non-protein) defined in Assay

COG

Interface to some part of the UniProt web service

What is COG service?

URL

https://www.ncbi.nlm.nih.gov/research/cog/webservices/

Citation

Database of Clusters of Orthologous Genes (COGs)

—From COG web site, Jan 2021

class COG(verbose=False, cache=False)[source]

Interface to the COG service

from bioservices import COG c = COG() cogs = c.get_all_cogs() # This is a pandas dataframe

Constructor

get_all_cogs_definition()[source]

Get all COG Definitions:

get_cog_definition_by_cog_id(cog_id)[source]

Get specific COG Definitions by COG: COG0003

get_cog_definition_by_name(cog)[source]

Get specific COG Definitions by name: Thiamin-binding stress-response protein YqgV, UPF0045 family

get_cogs(page=1)[source]

Get COGs. Unfortunately, the API sends 10 COGS at a tine given a specific page.

The dictionary returned contains the results, count, previous and next page.

get_cogs_by_assembly_id(assembly_id)[source]

Filter COGs by assembly ID: GCA_000007185.1

get_cogs_by_category(category)[source]

Filter COGs by Taxonomic Category: ACTINOBACTERIA

get_cogs_by_category_(protein)[source]

Filter COGs by Protein name: AJP49128.1

get_cogs_by_category_id(category)[source]

Filter COGs by Taxonomic Category taxid: 651137

get_cogs_by_gene(gene)[source]

Filter COGs by gene tag: MK0280

get_cogs_by_id(cog_id)[source]

Filter COGs by COG ID tag: COG0003

get_cogs_by_id_and_category(cog_id, category)[source]

Filter COGs by COG id and Taxonomy Categories: COG0004 and CYANOBACTERIA

get_cogs_by_id_and_organism(cog_id, organism)[source]

Filter COGs by COG id and organism: COG0004 and Escherichia_coli_K-12_sub_MG1655

get_cogs_by_orgnanism(name)[source]

Filter COGs by organism name: Nitrosopumilus_maritimus_SCM1

get_cogs_by_taxon_id(taxon_id)[source]

Filter COGs by taxid: 1229908

get_taxonomic_categories()[source]

Get all Taxonomic Categories:

get_taxonomic_category_by_name(name)[source]

Get specific Taxonomic Category by name: ALPHAPROTEOBACTERIA

ENA

This module provides a class ENA

What is ENA

URL

https://www.ebi.ac.uk/ena

The European Nucleotide Archive (ENA) provides a comprehensive record of the world’s nucleotide sequencing information, covering raw sequencing data, sequence assembly information and functional annotation.

—From ENA web page Jan 2016

New in version 1.4.4.

class ENA(verbose=False, cache=False)[source]

Interface to ChEMBL

Here is a quick example to retrieve a target given its ChEMBL Id

>>> from bioservices import ENA
>>> s = ENA(verbose=False)

Retrieve read domain metadata in XML format:

print(e.get_data('ERA000092', 'xml'))

Retrieve assemble and annotated sequences in fasta format:

print(e.get_data('A00145', 'fasta'))

The range parameter can be used in combination to retrieve a subsequence from sequence entry A00145 from bases 3 to 63 using

e.get_data('A00145', 'fasta', fasta_range=[3,63])

Retrieve assembled and annotated subsequences in HTML format (same as above but in HTML page).

e.view_data(‘A00145’)

Retrieve expanded CON records:

To retrieve expanded CON records use the expanded=true parameter. For example, the expanded CON entry AL513382 in flat file format can be i obtained as follows:

e.get_data('AL513382', frmt='text', expanded=True)

Expanded CON records are different from CON records in two ways. Firstly, the expanded CON records contain the full sequence in addition to the contig assembly instructions. Secondly, if a CON record contains only source or gap features the expanded CON records will also display all features from the segment records.

Retrieve assembled and annotated sequence header in flat file format

To retrieve assembled and annotated sequence header in flat file format please use the header=true parameter, e.g.:

e.get_data(‘BN000065’, ‘text’, header=True)

Retrieve assembled and annotated sequence records using sequence versions:

e.get_data('AM407889.1', 'fasta')
e.get_data('AM407889.2', 'fasta')

Constructor

Parameters

verbose – set to False to prevent informative messages

data_warehouse()[source]
get_data(identifier, frmt, fasta_range=None, expanded=None, header=None, download=None)[source]
:param frmtxml, text, fasta, fastq, html, embl but does depend on the

entry

Example:

get_data(“/AL513382”, “embl”)

ENA API changed in 2020 but we tried to keep the same services in this method.

get_taxon(taxon)[source]
url = 'http://www.ebi.ac.uk/ena/browser/api'
EUtils

Interface to the EUtils web Service.

What is EUtils ?

URL

http://www.ncbi.nlm.nih.gov/books/NBK25499/

URL

http://www.ncbi.nlm.nih.gov/books/NBK25500/#chapter1.Demonstration_Programs

The Entrez Programming Utilities (E-utilities) are a set of eight server-side programs that provide a stable interface into the Entrez query and database system at the National Center for Biotechnology Information (NCBI). The E-utilities use a fixed URL syntax that translates a standard set of input parameters into the values necessary for various NCBI software components to search for and retrieve the requested data. The E-utilities are therefore the structured interface to the Entrez system, which currently includes 38 databases covering a variety of biomedical data, including nucleotide and protein sequences, gene records, three-dimensional molecular structures, and the biomedical literature.

—from http://www.ncbi.nlm.nih.gov/books/NBK25497/, March 2013

class EUtils(verbose=False, email='unknown', cache=False, xmlparser='EUtilsParser')[source]

Interface to NCBI Entrez Utilities service

Note

Technical note: the WSDL interface was dropped in july 2015 so we now use the REST service.

Warning

Read the guidelines before sending requests. No more than 3 requests per seconds otherwise your IP may be banned. You should provide your email by filling the email so that before being banned, you may be contacted.

There are a few methods such as ELink(), EFetch(). Here is an example on how to use EFetch() method to retrieve the FASTA sequence of a given identifier (34577063):

>>> from bioservices import EUtils
>>> s = EUtils()
>>> print(s.EFetch("protein", "34577063", rettype="fasta"))
>gi|34577063|ref|NP_001117.2| adenylosuccinate synthetase isozyme 2 [Homo sapiens]
MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTV
VVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFH
QAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLANQYKSIYPTLE
IDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVC
TGLGMPPQNVGEVYGVVKAYTTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAH
MINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKE
LPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF

Most of the methods take a database name as input. You can obtain the valid list by checking the databases attribute.

A few functions takes Identifier(s) as input. It could be a list of strings, list of numbers, or a string where identifiers are separated either by comma or spaces.

A few functions take an argument called term. You can use the AND keyword with spaces or + signs as separators:

Correct:   term=biomol mrna[properties] AND mouse[organism]
Correct:   term=biomol+mrna[properties]+AND+mouse[organism]

Other special characters, such as quotation marks (”) or the # symbol used in referring to a query key on the History server, could be represented by their URL encodings (%22 for “; %23 for #) or verbatim .:

Correct: term=#2+AND+"gene in genomic"[properties]
Correct: term=%232+AND+%22gene+in+genomic%22[properties]

For information about retmode and retype, please see:

http://www.ncbi.nlm.nih.gov/books/NBK25499/table/chapter4.T._valid_values_of__retmode_and/?report=objectonly

ECitMatch(bdata, **kargs)[source]
Parameters

bdata

Citation strings. Each input citation must be represented by a citation string in the following format:

journal_title|year|volume|first_page|author_name|your_key|

Multiple citation strings may be provided by separating the strings with a carriage return character (%0D) or simply \r or \n.

The your_key value is an arbitrary label provided by the user that may serve as a local identifier for the citation, and it will be included in the output.

all spaces must be replaced by + symbols and that citation strings should end with a final vertical bar |.

Only xml supported at the time of this implementation.

from bioservices import EUtils
s = EUtils()
print(s.ECitMatch("proc+natl+acad+sci+u+s+a|1991|88|3248|mann+bj|Art1|%0Dscience|1987|235|182|palmenberg+ac|Art2|"))
EFetch(db, id, retmode='text', **kargs)[source]

Access to the EFetch E-Utilities

Parameters
  • db (str) – database from which to retrieve UIDs.

  • id (str) – list of identifiers.

  • retmode – default to text (could be xml but not recommended).

  • rettype – could be fasta, summary, docsum

Returns

depends on retmode parameter.

Note

addition to NCBI: settings rettype to “dict” returns a dictionary

>>> ret = s.EFetch("omim", "269840")  --> ZAP70
>>> ret = s.EFetch("taxonomy", "9606", retmode="xml")
>>> [x.text for x in ret.getchildren()[0].getchildren() if x.tag=="ScientificName"]
['Homo sapiens']

>>> s = eutils.EUtils()
>>> s.EFetch("protein", "34577063", retmode="text", rettype="fasta")
>gi|34577063|ref|NP_001117.2| adenylosuccinate synthetase isozyme 2 [Homo sapiens]
MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTV
VVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFH
QAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLANQYKSIYPTLE
IDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVC
TGLGMPPQNVGEVYGVVKAYTTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAH
MINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKE
LPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF

Identifiers could be provided as a single string with comma-separated values, or a list of strings, a list of integers, or just one string or one integer but no mixing of types in the list:

>>> e.EFetch("protein", "352, 234", retmode="text", rettype="fasta")
>>> e.EFetch("protein", 352, retmode="text", rettype="fasta")
>>> e.EFetch("protein", [352], retmode="text", rettype="fasta")
>>> e.EFetch("protein", [352, 234], retmode="text", rettype="fasta")

retmode should be xml or text depending on the database. For instance, xml for pubmed:

>>> e.EFetch("pubmed", "20210808", retmode="xml")
>>> e.EFetch('nucleotide', id=15, retmode='xml')
>>> e.EFetch('nucleotide', id=15, retmode='text', rettype='fasta')
>>> e.EFetch('nucleotide', 'NT_019265', rettype='gb')

Other special characters, such as quotation marks (”) or the # symbol used in referring to a query key on the History server, should be represented by their URL encodings (%22 for “; %23 for #).

A useful command is the following one that allows to get back a GI identifier from its accession, which is common to NCBI/EMBL:

e.EFetch(db="nuccore",id="AP013055", rettype="seqid", retmode="text")

Changed in version 1.5.0: instead of “xml”, retmode can now be set to dict, in which case an XML is retrieved and converted to a dictionary if possible.

EGQuery(term, **kargs)[source]

Provides the number of records retrieved in all Entrez databases by a text query.

Parameters

term (str) – Entrez text query. Spaces may be replaced by ‘+’ signs. For very long queries (more than several hundred characters long), consider using an HTTP POST call. See the PubMed or Entrez help for information about search field descriptions and tags. Search fields and tags are database specific.

Returns

returns a json data structure

>>> ret = s.EGQuery("asthma")
>>> [(x.DbName, x.Count) for x in ret.eGQueryResult.ResultItem if x.Count!='0']

>>> ret = s.EGQuery("asthma")
>>> ret.eGQueryResult.ResultItem[0]
{'Count': '115241',
 'DbName': 'pmc',
 'MenuName': 'PubMed Central',
 'Status': 'Ok'}
EInfo(db=None, **kargs)[source]

Provides information about a database (e.g., number of records)

Parameters

db (str) – target database about which to gather statistics. Value must be a valid Entrez database name. See databases or don’t provide any value to obtain the entire list

Returns

a json data structure that depends on the value of databases (default to json)

>>> all_database_names = s.EInfo()
>>> # specific info about one database:
>>> ret = s.EInfo("taxonomy")
>>> ret[0]['count']
u'1445358'
>>> ret = s.EInfo('pubmed')
>>> ret[0]['fieldlist'][2]['fullname']
'Filter'

You can use the retmode parameter to ‘xml’ as well. In that case, you will need a XML parser.

>>> ret = s.EInfo("taxonomy")

Note

Note that the name in the XML or json outputs differ (some have lower cases, some have upper cases). This is inherent to the output of EUtils.

The Entrez links utility

Responds to a list of UIDs in a given database with either a list of related UIDs (and relevancy scores) in the same database or a list of linked UIDs in another Entrez database;

Parameters
  • db (str) – valid database from which to retrieve UIDs.

  • dbfrom (str) – Database containing the input UIDs. The value must be a valid database name (default = pubmed). This is the origin database of the link operation. If db and dbfrom are set to the same database value, then ELink will return computational neighbors within that database. Computational neighbors have linknames that begin with dbname_dbname (examples: protein_protein, pcassay_pcassay_activityneighbor).

  • id (str) – UID list. Either a single UID or a comma-delimited list Limited to 200 Ids

  • cmd (str) – ELink command mode. The command mode specified which function ELink will perform. Some optional parameters only function for certain values of cmd (see http://www.ncbi.nlm.nih.gov/books/NBK25499/#chapter4.ELink). Examples are neighbor, prlinks.

>>> # Example: Find related articles to PMID 20210808
>>> ret = s.ELink("pubmed", id="20210808", cmd="neighbor_score")

>>> ret = s.parse_xml(ret, 'EUtilsParser')
>>> ret.eLinkResult.LinkSet.LinkSetDb[0].Link[1]
{'Id': '16539535'}

>>> s.ELink(dbfrom="nucleotide", db="protein",
                  id="48819,7140345")
>>> s.ELink(dbfrom="nucleotide", db="protein",
                  id="48819,7140345")
>>> s.ELink(dbfrom='nuccore', id='21614549,219152114',
        cmd='ncheck')

Convert GI number to Taxon identifiers:

>>> s.ELink(dbfrom='nuccore', db="taxonomy", id='21614549,219152114')
EPost(db, id, **kargs)[source]

Accepts a list of UIDs from a given database,

stores the set on the History Server, and responds with a query key and web environment for the uploaded dataset.

Parameters
  • db (str) – a valid database

  • id – list of strings of strings

Returns

a dictionary with a Web Environment string and a QueryKey to be re-used in another EUtils.

ESearch(db, term, **kargs)[source]

Responds to a query in a given database

The response can be used later in ESummary, EFetch or ELink, along with the term translations of the query.

Parameters
  • db – a valid database

  • term – an Entrez text query

Note

see _get_esearch_params() for the list of valid parameters.

>>> ret = e.ESearch('protein', 'human', RetMax=5)
>>> ret = e.ESearch('taxonomy', 'Staphylococcus aureus[all names]')
>>> ret = e.ESearch('pubmed', "cokelaer AND BioServices")

>>> ret = e.ESearch('protein', '15718680')
>>> # Let us show the first pubmed identifier in a browser
>>> identifiers = e.pubmed(ret['idlist'][0])

More complex requests can be used. We will not cover all the possiblities (see the NCBI website). Here is an example to tune the search term to look into PubMed for the journal PNAS Volume 16, and retrieve.:

>>> e.ESearch("pubmed", "PNAS[ta] AND 16[vi]")

You can then look more closely at a specific identifier using EFetch:

>>> e = EFetch("pubmed")
>>> e.Efetch(identifiers)

Note

valid parameters can be found by calling _get_esearch_params()

ESpell(db, term, **kargs)[source]

Retrieve spelling suggestions for a text query in a given database.

Parameters
  • db (str) – database to search. Value must be a valid Entrez database name (default = pubmed).

  • term (str) – Entrez text query. All special characters must be URL encoded.

>>> ret = e.ESpell(db="pubmed", term="aasthma+OR+alergy")
>>> ret = ret['eSpellResult']
>>> ret['Query']            'asthmaa OR alergies'
>>> ret['CorrectedQuery']
'asthma or allergy'
>>> ret = e.ESpell(db="pubmed", term="biosservices")
>>> ret = ret['eSpellResult']
>>> ret['CorrectedQuery']
bioservices
ESummary(db, id=None, **kargs)[source]

Returns document summaries for a list of input UIDs

Parameters
  • db – a valid database

  • id (str) – list of identifiers (or string comma separated). all of the UIDs must be from the database specified by db. Limited to 200 identifiers

>>> from bioservices import *
>>> s = EUtils()
>>> ret = s.ESummary("snp","7535")
>>> ret = s.ESummary("snp","7535,7530")
>>> ret = s.ESummary("taxonomy", "9606,9913")
>>> proteins = e.ESearch("protein", "bacteriorhodopsin",
        retmax=20)
>>> ret = e.ESummary("protein", 449301857)
>>> ret['result']['449301857']['extra']
'gi|449301857|gb|EMC97866.1||gnl|WGS:AEIF|BAUCODRAFT_31870'
property databases

Returns list of valid databases

email

fill this with your email address

help()[source]

Open EUtils help page

parse_xml(ret, method=None)[source]
snp_summary(id)[source]

Alias to Efetch for the SNP database

Return

a json data structure.

>>> ret = s.snp("123")
taxonomy_summary(id)[source]

Alias to EFetch for the taxonomy database

>>> s = EUtils()
>>> ret = s.taxonomy("9606")
>>> ret['9606']['species']
'sapiens'
>>> ret = s.taxonomy("9606,9605,111111111,9604")
>>> ret['9604']['taxid']
9604
class EUtilsParser(xml)[source]

Convert xml returned by EUtils into a structure easier to manipulate

Used by EUtils.EGQuery(), EUtils.ELink().

GeneProf

Currently removed from the main API from version 1.6.0 onwards. You can still get the code in earlier version or in the github repository in the attic/ directory

QuickGO

Interface to the quickGO interface

What is quickGO

URL

http://www.ebi.ac.uk/QuickGO/

Service

http://www.ebi.ac.uk/QuickGO/WebServices.html

“QuickGO is a fast web-based browser for Gene Ontology terms and annotations, which is provided by the UniProt-GOA project at the EBI. “

—from QuickGO home page, Dec 2012

class QuickGO(verbose=False, cache=False)[source]

Interface to the QuickGO service

Retrieve information given a GO identifier:

>>> from bioservices import QuickGO
>>> go = QuickGO()
>>> res = go.get_go_terms("GO:0003824")

Changed in version we: use the new QuickGO API since version 1.5.0 To use the old API, please use version of bioservices below 1.5

Constructor

Parameters

verbose (bool) – print informative messages.

Annotation(assignedBy=None, includeFields=None, limit=100, page=1, aspect=None, reference=None, geneProductId=None, evidenceCode=None, goId=None, qualifier=None, withFrom=None, taxonId=None, taxonUsage=None, goUsage=None, goUsageRelationships=None, evidenceCodeUsage=None, evidenceCodeUsageRelationships=None, geneProductType=None, targetSet=None, geneProductSubset=None, extension=None)[source]

Calling the Annotation service

Changed in version 1.4.18: due to service API changes, we refactored this method completely

Parameters
  • assignedBy (str) – The database from which this annotation originates. Accepts comma separated values.E.g., BHF-UCL,Ensembl.

  • includeFields (str) – Optional fields retrieved from external services. Accepts comma separated values. accepted values: goName, taxonName, name, synonyms.

  • limit (int) – download limit (number of lines) (default 10,000 rows, which may not be sufficient for the data set that you are downloading. To bypass this default, and return the entire data set, specify a limit of -1).

  • page (int) – results may be stored on several pages. You must provide this number. There is no way to retrieve more than 100 results without calling this function several times chanding this parameter (default to 1).

  • aspect (char) – use this to limit the annotations returned to a specific ontology or ontologies (Molecular Function, Biological Process or Cellular Component). The valid character can be F,P,C.

  • reference (str) – PubMed or GO reference supporting annotation. Can refer to a specific reference identifier or category (for category level, use * after ref type). Can be ‘PUBMED:*’, ‘GO_REF:0000002’.

  • geneProductId (str) – The id of the gene product annotated with the GO term. Accepts comma separated values.E.g., URS00000064B1_559292.

  • evidenceCode (str) – Evidence code indicating how the annotation is supported. Accepts comma separated values. E.g., ECO:0000255.

  • goId (str) – The GO id of an annotation. Accepts comma separated values. E.g., GO:0070125.

  • qualifier (str) – Aids the interpretation of an annotation. Accepts comma separated values. E.g., enables,involved_in.

  • withFrom (str) – Additional ids for an annotation. Accepts comma separated values. E.g., P63328.

  • taxonId (str) – The taxonomic id of the species encoding the gene product associated to an annotation. Accepts comma separated values. E.g., 1310605.

  • taxonUsage (str) – Indicates how the taxonomic ids within the annotations should be used. E.g., exact.

  • goUsage (str) – Indicates how the GO terms within the annotations should be used. Used in conjunction with ‘goUsageRelationships’ filter. E.g., descendants.

  • goUsageRelationships (str) – The relationship between the ‘goId’ values found within the annotations. Allows comma separated values. E.g., is_a,part_of.

  • evidenceCodeUsage (str) – Indicates how the evidence code terms within the annotations should be used. Is used in conjunction with ‘evidenceCodeUsageRelationships’ filter. E.g., descendants, exact<F12>

  • evidenceCodeUsageRelationships (str) – The relationship between the provided ‘evidenceCode’ identifiers. Allows comma separated values. E.g., is_a,part_of.

  • geneProductType (str) – The type of gene product. Accepts comma separated values. E.g., protein,RNA. can be protein, RNA and/or complex

  • targetSet (str) – Gene product set. Accepts comma separated values. E.g., KRUK,BHF-UCL,Exosome.

  • geneProductSubset (str) – A database that provides a set of gene products. Accepts comma separated values. E.g., TrEMBL.

  • extension (str) – Extensions to annotations, where each extension can be: EXTENSION(DB:ID) / EXTENSION(DB) / EXTENSION.

Returns

a dictionary

>>> print(s.Annotation(protein='P12345', frmt='tsv', col="ref,evidence",
... reference='PMID:*'))
>>> print(s.Annotation(protein='P12345,Q4VCS5', frmt='tsv',
...     col="ref,evidence",reference='PMID:,Reactome:'))
Annotation_from_goid(goId, max_number_of_pages=25, **kargs)[source]

Returns a DataFrame containing annotation on a given GO identifier

Parameters

protein (str) – a GO identifier

Returns

all outputs are stored into a Pandas.DataFrame data structure.

All parameters from Annotation are also valid except format that is set to tsv and cols that is made of all possible column names.

get_go_ancestors(query, relations='is_a,part_of,occurs_in,regulates')[source]
get_go_chart(query)[source]
res = go.get_chart("GO:0022804")
with open("temp.png", "wb") as fout:
    fout.write(res)
get_go_children(query)[source]
get_go_paths(_from, _to, relations='is_a,part_of,occurs_in,regulates')[source]

Retrieves the paths between two specified sets of ontology terms. Each path is formed from a list of (term, relationship, term) triples.

paths = go.go_terms_path(”GO:0005215”, “GO:0003674”) # First path is found as the first item in the “results” paths[“results”][0]

get_go_terms(query, max_number_of_pages=None)[source]

Get information on all terms and page through the result

Parameters

query (str) – terms as string of comma seperated values

Searches a simple user query, e.g., query=apopto

Parameters
  • query (str) –

  • limit (int) – max 600

  • page (int) –

Kegg

This module provides a class KEGG to access to the REST KEGG interface. There are additional methods and functionalities added by BioServices.

Note

a previous imterface to the KEGG WSDL service was designed but the WSDL closed in Dec 2012.

What is KEGG ?

URL

http://www.kegg.jp/

REST

http://www.kegg.jp/kegg/rest/keggapi.html

weblink

http://www.genome.jp/kegg/rest/weblink.html

dbentries

http://www.genome.jp/kegg/rest/dbentry.html

“KEGG is a database resource for understanding high-level functions and utilities of the biological system, such as the cell, the organism and the ecosystem, from molecular-level information, especially large-scale molecular datasets generated by genome sequencing and other high-throughput experimental technologies (See Release notes for new and updated features). “

—KEGG home page, Jan 2013

Some terminology

The following list is a simplified list of terminology taken from KEGG API pages.

  • organisms (org) are made of a three-letter (or four-letter) code (e.g., hsa stands for Human Sapiens) used in KEGG (see organismIds).

  • db is a database name. See databases attribute and KEGG Databases Names and Abbreviations section.

  • entry_id is a unique identifier. It is a combination of the database name and the identifier of an entry joined by a colon sign (e.g. ‘embl:J00231’).

    Here are some examples of entry Ids:

    • genes_id: A KEGG organism and a gene name (e.g. ‘eco:b0001’).

    • enzyme_id: ‘ec’ and an enzyme code. (e.g. ‘ec:1.1.1.1’). See enzymeIds.

    • compound_id: ‘cpd’ and a compound number (e.g. ‘cpd:C00158’). Some compounds also have ‘glycan_id’ and both IDs are accepted and converted internally. See compoundIds.

    • drug_id: ‘dr’ and a drug number (e.g. ‘dr:D00201’). See drugIds.

    • glycan_id: ‘gl’ and a glycan number (e.g.

    • ‘gl:G00050’). Some glycans also have ‘compound_id’ and both IDs are accepted and converted internally. see glycanIds attribute.

    • reaction_id: ‘rn’ and a reaction number (e.g.

    • ‘rn:R00959’ is a reaction which catalyze cpd:C00103 into cpd:C00668). See reactionIds attribute.

    • pathway_id: ‘path’ and a pathway number. Pathway numbers prefixed by ‘map’ specify the reference pathway and pathways prefixed by a KEGG organism specify pathways specific to the organism (e.g. ‘path:map00020’, ‘path:eco00020’) See pathwayIds attribute.

    • motif_id: a motif database names (‘ps’ for prosite, ‘bl’ for blocks, ‘pr’ for prints, ‘pd’ for prodom, and ‘pf’ for pfam) and a motif entry name. (e.g. ‘pf:DnaJ’ means a Pfam database entry ‘DnaJ’).

    • ko_id: identifier made of ‘ko’ and a ko number (e.g. ‘ko:K02598’). See koIds attribute.

KEGG Databases Names and Abbreviations

Here is a list of databases used in KEGG API with their name and abbreviation:

Database Name

Abbrev

kid

pathway

path

map number

brite

br

br number

module

md

M number

disease

ds

H number

drug

dr

D number

environ

ev

E number

orthology

ko

K number

genome

genome

T number

genomes

gn

T number

genes

ligand

ligand

compound

cpd

C number

glycan

gl

G number

reaction

rn

R number

rpair

rp

RP number

rclass

rc

RC number

enzyme

ec

Database Entries

Database entries can be written in on of the following ways:

<dbentries> = <dbentry>1[+<dbentry>2...]
<dbentry> = <db:entry> | <kid> | <org:gene>

Each database entry is identified by:

db:entry

where “db” is the database name or its abbreviation shown above and “entry” is the entry name or the accession number that is uniquely assigned within the database. In reality “db” may be omitted, for the entry name called the KEGG object identifier (kid) is unique across KEGG.:

kid = database-dependent prefix + five-digit number

In the KEGG GENES database the db:entry combination must be specified. This is more specifically written as:

org:gene

where “org” is the three- or four-letter KEGG organism code or the T number genome identifier and “gene” is the gene identifier, usually locus_tag or ncbi GeneID, or the primary gene name.

class KEGG(verbose=False, cache=False)[source]

Interface to the KEGG service

This class provides an interface to the KEGG REST API. The weblink tools are partially accesible. All dbentries can be parsed into dictionaries using the KEGGParser

Here are some examples. In order to retrieve the entry of the gene identifier 7535 of the hsa organism, type:

from bioservices import KEGG
s = KEGG()
print(s.get("hsa:7535"))

The output is the raw ouput sent by KEGG API. See KEGGParser to parse this output.

See also

The Database Entries to know more about the db entries format.

Another example here below shows how to print the list of pathways of the human organism:

print(s.list("pathway", organism="hsa"))

Further post processing would allow you to retrieve the pathway Ids. However, we provide additional functions to the KEGG API so the previous code and post processing to extract the pathway Ids can be written as:

s.organism = "hsa"
s.pathwayIds

and similarly you can get all databases() output and database Ids easily. For example, for the reaction database:

s.reaction   # equivalent to s.list("reaction")
s.reactionIds

Other methods of interest are conv(), find(), get().

Constructor

Parameters

verbose (bool) – prints informative messages

Tnumber2code(Tnumber)[source]

Converts organism T number to its code

>>> from bioservices import KEGG
>>> s = KEGG()
>>> s.Tnumber2code("T01001")
'hsa'
property briteIds

returns list of brite Ids.

See also

list()

code2Tnumber(code)[source]

Converts organism code to its T number

>>> from bioservices import KEGG
>>> s = KEGG()
>>> s.code2Tnumber("hsa")
'T01001'
property compoundIds

returns list of compound Ids

See also

list()

conv(target, source)[source]

convert KEGG identifiers to/from outside identifiers

Parameters
  • target (str) – the target database (e.g., a KEGG organism).

  • source (str) – the source database (e.g., uniprot) or a valid dbentries; see below for details.

Returns

a dictionary with keys being the source and values being the target.

Here are the rules to set the target and source parameters.

If the second argument is not a dbentries, source and target parameters can be of two types:

  1. gene identifiers. If the target is a KEGG Id, then the source must be one of ncbi-gi, ncbi-geneid or uniprot.

    Note

    source and target can be swapped.

  2. chemical substance identifiers. If the target is one of the following kegg database: drug, compound, glycan then the source must be one of pubchem or chebi.

    Note

    again, source and target can be swapped

If the second argument is a dbentries, it can be again of two types:

  1. gene identifiers. The database used can be one ncbi-gi, ncbi-geneid, uniprot or any KEGG organism

  2. chemical substance identifiers. The database used can be one of drug, compound, glycan, pubchem or chebi only.

Note

if the second argument is a dbentries, target and dbentries cannot be swapped.

# conversion from NCBI GeneID to KEGG ID for E. coli genes
conv("eco","ncbi-geneid")
# inverse of the above example
conv("eco","ncbi-geneid")
#conversion from KEGG ID to NCBI GI
conv("ncbi-gi","hsa:10458+ece:Z5100")

To make it clear by taking another example, you can either convert an entire database to another (e.g., from uniprot to KEGG Id all human gene IDs):

uniprot_ids, kegg_ids = s.conv("hsa", "uniprot")

or a subset by providing a valid dbentries:

s.conv("hsa","up:Q9BV86+")

Warning

call to this function may be long. conv(“hsa”, “uniprot”) takes a minute suprinsingly, conv(“uniprot”, “hsa”) takes just a few seconds.

Changed in version 1.1: the output is now a dictionary, not a list of tuples

property databases

Returns list of valid KEGG databases.

dbinfo(database='kegg')[source]

Displays the current statistics of a given database

Parameters

database (str) – can be one of: kegg (default), brite, module, disease, drug, environ, ko, genome, compound, glycan, reaction, rpair, rclass, enzyme, genomes, genes, ligand or any organismIds.

from bioservices import KEGG
s = KEGG()
s.dbinfo("hsa") # human organism
s.dbinfo("T01001") # same as above
s.dbinfo("pathway")

Changed in version 1.4.1: renamed info method into dbinfo(), which clashes with Logging framework info() method.

property drugIds

returns list of drug Ids

See also

list()

entry(dbentries)[source]

Retrieve entry

There is a weblink service (see http://www.genome.jp/kegg/rest/weblink.html) Since it is equivalent to get(), we do not implement it for now

property enzymeIds

returns list of enzyme Ids

See also

list()

find(database, query, option=None)[source]

finds entries with matching query keywords or other query data in a given database

Parameters
  • database (str) – can be one of pathway, module, disease, drug, environ, ko, genome, compound, glycan, reaction, rpair, rclass, enzyme, genes, ligand or an organism code (see organismIds attributes) or T number (see organismTnumbers attribute).

  • query (str) – See examples

  • option (str) – If option provided, database can be only ‘compound’ or ‘drug’. Option can be ‘formula’, ‘exact_mass’ or ‘mol_weight’

Note

Keyword search against brite is not supported. Use /list/brite to retrieve a short list.

# search for pathways that contain Viral in the definition
s.find("pathway", "Viral")
# for keywords "shiga" and "toxin"
s.find("genes", "shiga+toxin")
# for keywords "shiga toxin"
s.find("genes", ""shiga toxin")
# for chemical formula "C7H10O5"
s.find("compound", "C7H10O5", "formula")
# for chemical formula containing "O5" and "C7"
s.find("compound", "O5C7","formula")
# for 174.045 =< exact mass < 174.055
s.find("compound", "174.05","exact_mass")
# for 300 =< molecular weight =< 310
s.find("compound", "300-310","mol_weight")
get(dbentries, option=None, parse=False)[source]

Retrieves given database entries

param str dbentries

KEGG database entries involving the following database: pathway, brite, module, disease, drug, environ, ko, genome compound, glycan, reaction, rpair, rclass, enzyme or any organism using the KEGG organism code (see organismIds attributes) or T number (see organismTnumbers attribute).

param str option

one of: aaseq, ntseq, mol, kcf, image, kgml

Note

you can add the option at the end of dbentries in which case

the parameter option must not be used (see example)

from bioservices import KEGG
s = KEGG()
# retrieves a compound entry and a glycan entry
s.get("cpd:C01290+gl:G00092")
# same as above
s.get("C01290+G00092")
# retrieves a human gene entry and an E.coli O157 gene entry
s.get("hsa:10458+ece:Z5100")
# retrieves amino acid sequences of a human gene and an E.coli O157 gene
s.get("hsa:10458+ece:Z5100/aaseq")
# retrieves the image file of a pathway map
s.get("hsa05130/image")
# same as above
s.get("hsa05130", "image")

# to retrieve genome, you must preceed the entry with gn:
s.get('gn:T01001')
# to retrieve a network, you must preceed it with network:
s.get('network:nt06214')

Another example here below shows how to save the image of a given pathway:

res =  s.get("hsa05130/image")
 # same as : res =  s.get("hsa05130","image")
 f = open("test.png", "w")
 f.write(res)
 f.close()

Note

The input is limited up to 10 entries (KEGG restriction).

get_pathway_by_gene(gene, organism)[source]

Search for pathways that contain a specific gene

Parameters
  • gene (str) – a valid gene Id

  • organism (str) – a valid organism (e.g., hsa)

Returns

list of pathway Ids that contain the gene

>>> s.get_pathway_by_gene("7535", "hsa")
['path:hsa04064', 'path:hsa04650', 'path:hsa04660', 'path:hsa05340']
property glycanIds

Returns list of glycan Ids

See also

list()

isOrganism(org)[source]

Checks if org is a KEGG organism

Parameters

org (str) –

Returns

True if org is in the KEGG organism list (code or Tnumber)

>>> from bioservices import KEGG
>>> s = KEGG()
>>> s.isOrganism("hsa")
True
property koIds

returns list of ko Ids

See also

list()

Find related entries by using database cross-references

Parameters
  • target (str) – the target KEGG database or organism (see below for the list).

  • source (str) – the source KEGG database or organism (see below for the list) or a valid dbentries involving one of the database; see below for details.

The valid list of databases is pathway, brite, module, disease, drug, environ, ko, genome, compound, glycan, reaction, rpair, rclass, enzyme

# KEGG pathways linked from each of the human genes
s.link("pathway", "hsa")
# human genes linked from each of the KEGG pathways
s.link("hsa", "pathway")
# KEGG pathways linked from a human gene and an E. coli O157 gene.
s.link("pathway", "hsa:10458+ece:Z5100")
list(query, organism=None)[source]

Returns a list of entry identifiers and associated definition for a given database or a given set of database entries

Parameters
  • query (str) – can be one of pathway, brite, module, disease, drug, environ, ko, genome, compound, glycan, reaction, rpair, rclass, enzyme, organism or an organism from the organismIds attribute or a valid dbentry (see below). If a dbentry query is provided, organism should not be used!

  • organism (str) – a valid organism identifier that can be provided. If so, database can be only “pathway” or “module”. If not provided, the default value is chosen (organism)

Returns

A string with a structure that depends on the query

Here is an example that shows how to extract the pathways IDs related to the hsa organism:

>>> s = KEGG()
>>> res = s.list("pathway", organism="hsa")
>>> pathways = [x.split()[0] for x in res.strip().split("\n")]
>>> len(pathways)  # as of Dec 2012
261

Note, however, that there are convenient aliases to some of the databases. For instance, the pathway Ids can also be retrieved as a list from the pathwayIds attribute (after defining the organism attribute).

Note

If you set the query to a valid organism, then the second argument rganism is irrelevant and ignored.

Note

If the query is not a database or an organism, it is supposed to be a valid dbentries string and the maximum number of entries is 100.

Other examples:

s.list("pathway")             # returns the list of reference pathways
s.list("pathway", "hsa")      # returns the list of human pathways
s.list("organism")            # returns the list of KEGG organisms with taxonomic classification
s.list("hsa")                 # returns the entire list of human genes
s.list("T01001")              # same as above
s.list("hsa:10458+ece:Z5100") # returns the list of a human gene and an E.coli O157 gene
s.list("cpd:C01290+gl:G00092")# returns the list of a compound entry and a glycan entry
s.list("C01290+G00092")       # same as above
lookfor_organism(query)[source]

Look for a specific organism

Parameters

query (str) – your search term. upper and lower cases are ignored

Returns

a list of definition that matches the query

lookfor_pathway(query)[source]

Look for a specific pathway

Parameters

query (str) – your search term. upper and lower cases are ignored

Returns

a list of definition that matches the query

property moduleIds

returns list of module Ids for the default organism.

organism must be set.

s = KEGG()
s.organism = "hsa"
s.moduleIds
property organism

returns the current default organism

property organismIds

Returns list of organism Ids

property organismTnumbers

returns list of organisms (T numbers)

See also

list()

parse(entry)[source]

See KEGGParser for details

Parse entry returned by get()

k = KEGG()
res = k.get("hsa04150")
d = k.parse(res)
parse_kgml_pathway(pathwayId, res=None)[source]

Parse the pathway in KGML format and returns a dictionary (relations and entries)

Parameters
  • pathwayId (str) – a valid pathwayId e.g. hsa04660

  • res (str) – if you already have the output of the query get(pathwayId), you can provide it, otherwise it is queried.

Returns

a dictionary with relations and entries as keys. Values of relations is a list of relations, each relation being dictionary with entry1, entry2, link, value, name. The list os entries is a list of dictionary as well. Entry contains contains more details about the entry found in the relation. See example below for details.

>>> res = s.parse_kgml_pathway("hsa04660")
>>> set([x['name'] for x in res['relations']])
>>> res['relations'][-1]
{'entry1': u'15',
 'entry2': u'13',
 'link': u'PPrel',
 'name': u'phosphorylation',
 'value': u'+p'}

>>> set([x['link'] for x in res['relations']])
set([u'PPrel', u'PCrel'])

>>> # get information about an entry :
>>> res['entries'][4]

See also

KEGG API

pathway2sif(pathwayId, uniprot=True)[source]

Extract protein-protein interaction from KEGG pathway to a SIF format

Warning

experimental Not tested on all pathway. should be move to another package such as cellnopt

Parameters
  • pathwayId (str) – a valid pathway Id

  • uniprot (bool) – convert to uniprot Id or not (default is True)

Returns

a list of relations (A 1 B) for activation and (A -1 B) for inhibitions

This is longish due to the conversion from KEGGIds to UniProt.

This method can be useful to provide prior knowledge network to software such as CellNOpt (see http://www.cellnopt.org)

property pathwayIds

returns list of pathway Ids for the default organism.

organism must be set.

s = KEGG()
s.organism = "hsa"
s.pathwayIds
property reactionIds

returns list of reaction Ids

save_pathway(pathId, filename, scale=None, keggid={}, params={})[source]

Save KEGG pathway in PNG format

Parameters
  • pathId – a valid pathway identifier

  • filename (str) – output PNG file

  • params – valid kegg params expected

show_entry(entry)[source]

Opens URL corresponding to a valid entry

s.www_bget("path:hsa05416")
show_module(modId)[source]

Show a given module inside a web browser

Parameters

modId (str) – a valid module Id. See moduleIds()

Validity of modId is not checked but if wrong the URL will not open a proper web page.

show_pathway(pathId, scale=None, dcolor='pink', keggid={}, show=True)[source]

Show a given pathway inside a web browser

Parameters
  • pathId (str) – a valid pathway Id. See pathwayIds()

  • scale (int) – you can scale the image with a value between 0 and 100

  • dcolor (str) – set the default background color of nodes

  • keggid (dict) – set color of entries contained in the pathway as key/value pairs; can also be a list, in which case all nodes have the same default color (red)

Note

if scale is provided, dcolor and keggid are ignored.

# show a pathway in the browser
s.show_pathway("path:hsa05416", scale=50)

# Same as above but also highlights some KEGG Ids (red for all)
s.show_pathway("path:hsa05416", dcolor="white",
    keggid=['1525', '1604', '2534'])

# You can refine the colors using a dictionary:
s.show_pathway("path:hsa05416", dcolor="white",
    keggid={'1525':'yellow,red', '1604':'blue,green', '2534':"blue"})
class KEGGParser(verbose=False)[source]

This is an extension of the KEGG class to ease parsing of dbentries

This class provides a generic method parse() that will read the output of a dbentry returned by KEGG.get() and converts it into a dictionary ready to use.

The parse() method parses any entry. It can be a pathway, a gene, a compound…

from bioservices import *
s = KEGG()

# Retrieve a KEGG entry
res = s.get("hsa04150")

# parse it
d = s.parse(res)

As a pedagogical example, you can then further process this dictionary. Here below, we convert the gene Ids found in the pathway into UniProt Ids:

# Get the KEGG Ids in the pathway
kegg_geneIds = [x for x in d['GENE']]

# Convert them
db_up, db_kegg = s.conv("hsa", "uniprot")

# Get the corresponding uniprot Ids
indices = [db_kegg.index("hsa:%s" % x ) for x in kegg_geneIds]
uniprot_geneIds = [db_up[x] for x in indices]

However, you could also have done it simply as follows:

kegg_geneIds = [x for x in d['gene']]
uprot_geneIds = [s.parse(s.get("hsa:"+str(e)))['DBLINKS']["UniProt:"] for e in d['GENE']]

Note

The 2 outputs are slightly different.

parse(res)[source]

Parse to any outputs returned by KEGG.get()

Parameters

res (str) – output of a KEGG.get().

Returns

a dictionary. Keys are those found in the KEGG entry (e.g., REACTION, ENTRY, EQUATION, …). The format of each value is various. It could be a string, a list (of strings generally), a dictionary, a float depending on the key. Depdending on the type of the entry (e.g., module, pathway), the type of the value may also differ (e.g., REACTION can be either a list of reactions or a dictionary depending on the content)

>>> # Parses a drug entry
>>> res = s.get("dr:D00001")
>>> # Parses a pathway entry
>>> res = s.get("path:hsa10584")
>>> # Parses a module entry
>>> res = s.get("md:hsa_M00554")
>>> # Parses a disease entry
>>> res = s.get("ds:H00001")
>>> # Parses a environ entry
>>> res = s.get("ev:E00001")
>>> # Parses Orthology entry
>>> res = s.get("ko:K00001")
>>> # Parses a Genome entry
>>> res = s.get('genome:T00001')
>>> # Parses a gene entry
>>> res = s.get("hsa:1525")
>>> # Parses a compound entry
>>> s.get("cpd:C00001")
>>> # Parses a glycan entry
>>> res = s.get("gl:G00001")
>>> # Parses a reaction entry
>>> res = s.get("rn:R00001")
>>> # Parses a rpair entry
>>> res = s.get("rp:RP00001")
>>> # Parses a rclass entry
>>> res = s.get("rc:RC00001")
>>> # Parses an enzyme entry
>>> res = s.get('ec:1.1.1.1')

>>> d = s.parse(res)
HGNC

Interface to HUGO/HGNC web services

What is HGNC ?

URL

http://www.genenames.org

Citation

“The HUGO Gene Nomenclature Committee (HGNC) has assigned unique gene symbols and names to over 37,000 human loci, of which around 19,000 are protein coding. genenames.org is a curated online repository of HGNC-approved gene nomenclature and associated resources including links to genomic, proteomic and phenotypic information, as well as dedicated gene family pages.”

—From HGNC web site, July 2013

class HGNC(verbose=False, cache=False)[source]

Wrapper to the genenames web service

See details at http://www.genenames.org/help/rest-web-service-help

fetch(database, query, frmt='json')[source]

Retrieve particular records from a searchable fields

Returned object is a json object with fields as in stored_field, which is returned from get_info() method.

Only one query at a time. No wild cards are accepted.

>>> h = HGNC()
>>> h.fetch('symbol', 'ZNF3')
>>> h.fetch('alias_name', 'A-kinase anchor protein, 350kDa')
get_info(frmt='json')[source]

Request information about the service

Fields are when the server was last updated (lastModified), the number of documents (numDoc), which fields can be queried using search and fetch (searchableFields) and which fields may be returned by fetch (storedFields).

search(database_or_query=None, query=None, frmt='json')[source]

Search a searchable field (database) for a pattern

The search request is more powerful than fetch for querying the database, but search will only returns the fields hgnc_id, symbol and score. This is because this tool is mainly intended to query the server to find possible entries of interest or to check data (such as your own symbols) rather than to fetch information about the genes. If you want to retrieve all the data for a set of genes from the search result, the user could use the hgnc_id returned by search to then fire off a fetch request by hgnc_id.

Parameters

database – if not provided, search all databases.

# Search all searchable fields for the tern BRAF
h.search('BRAF')

# Return all records that have symbols that start with ZNF
h.search('symbol', 'ZNF*')

# Return all records that have symbols that start with ZNF
# followed by one and only one character (e.g. ZNF3)
# Nov 2015 does not work neither here nor in within in the
# official documentation
h.search('symbol', 'ZNF?')

# search for symbols starting with ZNF that have been approved
# by HGNC
h.search('symbol', 'ZNF*+AND+status:Approved')

# return ZNF3 and ZNF12
h.search('symbol', 'ZNF3+OR+ZNF12')

# Return all records that have symbols that start with ZNF which
# are not approved (ie entry withdrawn)
h.search('symbol', 'ZNF*+NOT+status:Approved')
Intact (complex)

This module provides a class IntactComplex

What is Intact Complex ?

URL

https://www.ebi.ac.uk/intact/complex/

REST

https://www.ebi.ac.uk/intact/complex-ws/details/

“The Complex Portal is a manually curated, encyclopaedic resource of macromolecular complexes from a number of key model organisms.”

—From Intact web page Feb 2015

class IntactComplex(verbose=False, cache=False)[source]

Interface to the Intact service

>>> from bioservices import IntactComplex
>>> u = IntactComplex()

Constructor IntactComplex

Parameters

verbose – set to False to prevent informative messages

details(query)[source]

Return details about a complex

Parameters

query (str) – EBI-1163476

search(query, frmt='json', facets=None, first=None, number=None, filters=None)[source]

Search for a complex inside intact complex.

Parameters
  • query (str) – the query (e.g., ndc80)

  • frmt (str) – Defaults to json (could be a Pandas data frame if Pandas is installed; set frmt to ‘pandas’)

  • facets (str) – lists of facets as a string (separated by comma)

  • first (int) –

  • number (int) –

  • filter (str) – list of filters. See examples here below.

s = IntactComplex()
# search for ndc80
s.search('ncd80')

#  Search for ndc80 and facet with the species field:
s.search('ncd80', facets='species_f')

# Search for ndc80 and facet with the species and biological role fields:
s.search('ndc80', facets='species_f,pbiorole_f')

# Search for ndc80, facet with the species and biological role
# fields and filter the species using human:
s.search('Ndc80', first=0, number=10,
    filters='species_f:("Homo sapiens")',
    facets='species_f,ptype_f,pbiorole_f')

# Search for ndc80, facet with the species and biological role
# fields and filter the species using human or mouse:
s.search('Ndc80, first=0, number=10,
    filters='species_f:("Homo sapiens" "Mus musculus")',
    facets='species_f,ptype_f,pbiorole_f')

# Search with a wildcard to retrieve all the information:
s.search('*')

# Search with a wildcard to retrieve all the information and facet
# with the species, biological role and interactor type fields:
s.search('*', facets='species_f,pbiorole_f,ptype_f')

# Search with a wildcard to retrieve all the information, facet with
# the species, biological role and interactor type fields and filter
# the interactor type using small molecule:
s.search('*', facets='species_f,pbiorole_f,ptype_f',
    filters='ptype_f:("small molecule")'

# Search with a wildcard to retrieve all the information, facet with
# the species, biological role and interactor type fields and filter
# the interactor type using small molecule and the species using human:
s.search('*', facets='species_f,pbiorole_f,ptype_f',
    filters='ptype_f:("small molecule"),species_f:("Homo sapiens")')

# Search for GO:0016491 and paginate (first is for the offset and number
# is how many do you want):
s.search('GO:0016491', first=10, number=10)

The organism name used in the filter must be exact. Here is the list found by typing:

res = set(ci.search('*', frmt='pandas')['organismName'])
'Bos taurus; 9913',
'Caenorhabditis elegans; 6239',
'Canis familiaris; 9615',
'Drosophila melanogaster; 7227',
'Escherichia coli (strain K12); 83333',
'Gallus gallus; 9031',
'Homo sapiens; 9606',
'Mus musculus; 10090',
'Oryctolagus cuniculus; 9986',
'Rattus norvegicus; 10116',
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c);559292',
'Schizosaccharomyces pombe (strain 972 / ATCC 24843);284812',
'Xenopus laevis; 8355'
MUSCLE

Interface to the MUSCLE web service

What is MUSCLE ?

URL

http://www.drive5.com/muscle/

service

http://www.ebi.ac.uk/Tools/webservices/services/msa/muscle_rest

“MUSCLE - (MUltiple Sequence Comparison by Log-Expectation) 1)

is claimed to achieve both better average accuracy and better speed than ClustalW or T-Coffee, depending on the chosen options. Multiple alignments of protein sequences are important in many applications, including phylogenetic tree estimation, secondary structure prediction and critical residue identification.”

—from EMBL-EBI web page

class MUSCLE(verbose=False)[source]

Interface to the MUSCLE service.

>>> from bioservices import *
>>> m = MUSCLE(verbose=False)
>>> sequencesFasta = open('filename','r')
>>> jobid = n.run(frmt="fasta", sequence=sequencesFasta.read(),
                email="name@provider")
>>> s.getResult(jobid, "out")

Warning

It is very important to provide a real e-mail address as your job otherwise very likely will be killed and your IP, Organisation or entire domain black-listed.

Here is another similar example but we use UniProt class provided in bioservices to fetch the FASTA sequences:

>>> from bioservices import UniProt, MUSCLE
>>> u = UniProt(verbose=False)
>>> f1 = u.get_fasta("P18413")
>>> f2 = u.get_fasta("P18412")
>>> m = MUSCLE(verbose=False)
>>> jobid = m.run(frmt="fasta", sequence=f1+f2, email="name@provider")
>>> m.getResult(jobid, "out")
get_parameter_details(parameterId)[source]

Get detailed information about a parameter.

Returns

An XML document providing details about the parameter or a list of values that can take the parameters if the XML could be parsed.

For example:

>>> n.get_parameter_details("format")
get_parameters()[source]

List parameter names.

Returns

An XML document containing a list of parameter names.

>>> from bioservices import muscle
>>> n = muscle.Muscle()
>>> res = n.get_parameters()
>>> [x.text for x in res.findAll("id")]

See also

parameters to get a list of the parameters without need to process the XML output.

get_result(jobid, result_type)[source]

Get the job result of the specified type.

Parameters
  • jobid (str) – a job identifier returned by run().

  • resultType (str) – type of result to retrieve. See getResultTypes().

get_result_types(jobid)[source]

Get available result types for a finished job.

Parameters
  • jobid (str) – a job identifier returned by run().

  • verbose (bool) – print the identifiers together with their label, mediaTypes, description and filesuffix.

Returns

A dictionary, which keys correspond to the identifiers. Each identifier is itself a dictionary containing the label, description, file suffix and mediaType of the identifier.

get_status(jobid)[source]

Get status of a submitted job

Parameters
  • jobid (str) –

  • jobid – a job identifier returned by run().

Returns

A string giving the jobid status (e.g. FINISHED).

The values for the status are:

  • RUNNING: the job is currently being processed.

  • FINISHED: job has finished, and the results can then be retrieved.

  • ERROR: an error occurred attempting to get the job status.

  • FAILURE: the job failed.

  • NOT_FOUND: the job cannot be found.

property parameters
run(frmt=None, sequence=None, tree='none', email=None)[source]

Submit a job with the specified parameters.

Compulsary arguments

Parameters
  • frmt (str) – input format (e.g., fasta)

  • sequence (str) – query sequence. The use of fasta formatted sequence is recommended.

  • tree (str) – tree type (‘none’,’tree1’,’tree2’)

  • email (str) – a valid email address. Will be checked by the service itself.

Returns

A jobid that can be analysed with getResult(), getStatus(), …

The up to data values accepted for each of these parameters can be retrieved from the get_parameter_details().

For instance,:

from bioservices import MUSCLE
m = MUSCLE()
m.parameterDetails("tree")

Example:

jobid = m.run(frmt="fasta",
     sequence=sequence_example,
     email="test@yahoo.fr")

frmt can be a list of formats:

frmt=['fasta','clw','clwstrict','html','msf','phyi','phys']

The returned object is a jobid, which status can be checked. It must be finished before analysing/geeting the results.

See also

getResult()

wait(jobId, checkInterval=5, verbose=True)[source]

This function checks the status of a jobid while it is running

Parameters
  • jobid (str) – a job identifier returned by run().

  • checkInterval (int) – interval between requests in seconds.

MyGeneInfo

Interface to the mygeneinfo web Service.

What is MyGeneInfo ?

URL

https://mygene.info

REST

https://mygeneinfo/v3.api/

MyGene.info provides simple-to-use REST web services to query/retrieve gene annotation data. It’s designed with simplicity and performance emphasized. You can use it to power a web application which requires querying genes and obtaining common gene annotations. For example, MyGene.info services are used to power BioGPS; or use it in an analysis pipeline to retrieve always up-to-date gene annotations.

—mygene.info home page, June 2020

class MyGeneInfo(verbose=False, cache=False)[source]

Interface to mygene.infoe service

>>> from bioservices import MyGeneInfo
>>> s = MyGeneInfo()

Constructor

Parameters

verbose (bool) – prints informative messages (default is off)

get_genes(ids, fields='symbol,name,taxid,entrezgene,ensemblgene', species=None, dotfield=True, email=None)[source]

Get matching gene objects for a list of gene ids

Parameters
  • ids – list of geneinfo IDs

  • fields (str) – a comma-separated fields to limit the fields returned from the matching gene hits. The supported field names can be found from any gene object (e.g. http://mygene.info/v3/gene/1017). Note that it supports dot notation as well, e.g., you can pass “refseq.rna”. If “fields=all”, all available fields will be returned. Default: “symbol,name,taxid,entrezgene,ensemblgene”.

  • species (str) – can be used to limit the gene hits from given species. You can use “common names” for nine common species (human, mouse, rat, fruitfly, nematode, zebrafish, thale-cress, frog and pig). All other species, you can provide their taxonomy ids. Multiple species can be passed using comma as a separator. Default: human,mouse,rat.

  • dotfield – control the format of the returned fields when passed “fields” parameter contains dot notation, e.g. “fields=refseq.rna”. If True the returned data object contains a single “refseq.rna” field, otherwise (False), a single “refseq” field with a sub-field of “rna”. Default: True.

  • email" (str) – If you are regular users of this services, the mygeneinfo maintainers/authors encourage you to provide an email, so that we can better track the usage or follow up with you.

mgi = MyGeneInfoe()
mgi.get_genes(("301345,22637"))
# first one is rat, second is mouse. This will return a 'notfound'
# entry and the second entry as expected.
mgi.get_genes("301345,22637", species="mouse")
get_metadata()[source]
get_one_gene(geneid, fields='symbol,name,taxid,entrezgene,ensemblgene', dotfield=True, email=None)[source]

Get matching gene objects for one gene id

Parameters
  • geneid – a valid gene ID

  • fields (str) – a comma-separated fields to limit the fields returned from the matching gene hits. The supported field names can be found from any gene object (e.g. http://mygene.info/v3/gene/1017). Note that it supports dot notation as well, e.g., you can pass “refseq.rna”. If “fields=all”, all available fields will be returned. Default: “symbol,name,taxid,entrezgene,ensemblgene”.

  • dotfield – control the format of the returned fields when passed “fields” parameter contains dot notation, e.g. “fields=refseq.rna”. If True the returned data object contains a single “refseq.rna” field, otherwise (False), a single “refseq” field with a sub-field of “rna”. Default: True.

  • email" (str) – If you are regular users of this services, the mygeneinfo maintainers/authors encourage you to provide an email, so that we can better track the usage or follow up with you.

mgi = MyGeneInfoe()
mgi.get_genes("301345")
get_one_query(query, email=None, dotfield=True, fields='symbol,name,taxid,entrezgene,ensemblgene', species='human,mouse,rat', size=10, _from=0, sort=None, facets=None, entrezonly=False, ensemblonly=False)[source]

Make gene query and return matching gene list. Support JSONP and CORS as well.

Parameters
  • query (str) – Query string. Examples “CDK2”, “NM_052827”, “204639_at”, “chr1:151,073,054-151,383,976”, “hg19.chr1:151073054-151383976”. The detailed query syntax can be found from our docs.

  • fields (str) – a comma-separated fields to limit the fields returned from the matching gene hits. The supported field names can be found from any gene object (e.g. http://mygene.info/v3/gene/1017). Note that it supports dot notation as well, e.g., you can pass “refseq.rna”. If “fields=all”, all available fields will be returned. Default: “symbol,name,taxid,entrezgene,ensemblgene”.

  • species (str) – can be used to limit the gene hits from given species. You can use “common names” for nine common species (human, mouse, rat, fruitfly, nematode, zebrafish, thale-cress, frog and pig). All other species, you can provide their taxonomy ids. Multiple species can be passed using comma as a separator. Default: human,mouse,rat.

  • size (int) – the maximum number of matching gene hits to return (with a cap of 1000 at the moment). Default: 10.

  • _from (int) – the number of matching gene hits to skip, starting from 0. Combining with “size” parameter, this can be useful for paging. Default: 0.

  • sort – the comma-separated fields to sort on. Prefix with “-” for descending order, otherwise in ascending order. Default: sort by matching scores in decending order.

  • facets (str) – a single field or comma-separated fields to return facets, for example, “facets=taxid”, “facets=taxid,type_of_gene”.

  • entrezonly (bool) – when passed as True, the query returns only the hits with valid Entrez gene ids. Default: False.

  • ensembleonly (bool) – when passed as True, the query returns only the hits with valid Ensembl gene ids. Default: False.

  • dotfield – control the format of the returned fields when passed “fields” parameter contains dot notation, e.g. “fields=refseq.rna”. If True the returned data object contains a single “refseq.rna” field, otherwise (False), a single “refseq” field with a sub-field of “rna”. Default: True.

  • email" (str) – If you are regular users of this services, the mygeneinfo maintainers/authors encourage you to provide an email, so that we can better track the usage or follow up with you.

get_queries(query, email=None, dotfield=True, scopes='all', species='human,mouse,rat', fields='symbol,name,taxid,entrezgene,ensemblgene')[source]

Make gene query and return matching gene list. Support JSONP and CORS as well.

Parameters
  • query (str) – Query string. Examples “CDK2”, “NM_052827”, “204639_at”, “chr1:151,073,054-151,383,976”, “hg19.chr1:151073054-151383976”. The detailed query syntax can be found from our docs.

  • fields (str) – a comma-separated fields to limit the fields returned from the matching gene hits. The supported field names can be found from any gene object (e.g. http://mygene.info/v3/gene/1017). Note that it supports dot notation as well, e.g., you can pass “refseq.rna”. If “fields=all”, all available fields will be returned. Default: “symbol,name,taxid,entrezgene,ensemblgene”.

  • species (str) – can be used to limit the gene hits from given species. You can use “common names” for nine common species (human, mouse, rat, fruitfly, nematode, zebrafish, thale-cress, frog and pig). All other species, you can provide their taxonomy ids. Multiple species can be passed using comma as a separator. Default: human,mouse,rat.

  • dotfield – control the format of the returned fields when passed “fields” parameter contains dot notation, e.g. “fields=refseq.rna”. If True the returned data object contains a single “refseq.rna” field, otherwise (False), a single “refseq” field with a sub-field of “rna”. Default: True.

  • email" (str) – If you are regular users of this services, the mygeneinfo maintainers/authors encourage you to provide an email, so that we can better track the usage or follow up with you.

  • scopes (str) – not documented. Set to ‘all’

get_taxonomy()[source]
NCBIblast

Interface to the NCBIBLAST web service

What is NCBIBLAST ?

URL

http://blast.ncbi.nlm.nih.gov/

service

http://www.ebi.ac.uk/Tools/webservices/services/sss/ncbi_blast_rest

“NCBI BLAST - Protein Database Query

The emphasis of this tool is to find regions of sequence similarity, which will yield functional and evolutionary clues about the structure and function of your novel sequence.”

—from NCBIblast web page

class NCBIblast(verbose=False)[source]

Interface to the NCBIblast service.

>>> from bioservices import *
>>> s = NCBIblast(verbose=False)
>>> jobid = s.run(program="blastp", sequence=s._sequence_example,
    stype="protein", database="uniprotkb", email="name@provider")
>>> s.getResult(jobid, "out")

Warning

It is very important to provide a real e-mail address as your job otherwise very likely will be killed and your IP, Organisation or entire domain black-listed.

When running a blast request, a program is required. You can obtain the list using:

>>> s.parametersDetails("program")
[u'blastp', u'blastx', u'blastn', u'tblastx', u'tblastn']
  • blastn: Search a nucleotide database using a nucleotide query

  • blastp: Search protein database using a protein query

  • blastx: Search protein database using a translated nucleotide query

  • tblastn Search translated nucleotide database using a protein query

  • tblastx Search translated nucleotide database using a translated nucleotide query

NCBIblast constructor

Parameters

verbose (bool) – prints informative messages

property databases

Returns accepted databases.

get_parameter_details(parameterId)[source]

Get detailed information about a parameter.

Returns

An XML document providing details about the parameter or a list of values that can take the parameters if the XML could be parsed.

For example:

>>> s.parameter_details("matrix")
[u'BLOSUM45',
 u'BLOSUM50',
 u'BLOSUM62',
 u'BLOSUM80',
 u'BLOSUM90',
 u'PAM30',
 u'PAM70',
 u'PAM250']
get_parameters()[source]

List parameter names.

Returns

An XML document containing a list of parameter names.

>>> from bioservices import ncbiblast
>>> n = ncbiblast.NCBIblast()
>>> res = n.get_parameters()
>>> [x.text for x in res.findAll("id")]

See also

parameters to get a list of the parameters without need to process the XML output.

get_result(jobid, result_type)[source]

Get the job result of the specified type.

param str jobid

a job identifier returned by run().

param str result_type

type of result to retrieve. See getResultTypes().

The output from the tool itself. Use the ‘format’ parameter to retireve the output in different formats, the ‘compressed’ parameter to retrieve the xml output in compressed form. Format options:

0 = pairwise,
1 = query-anchored showing identities,
2 = query-anchored no identities,
3 = flat query-anchored showing identities,
4 = flat query-anchored no identities,
5 = XML Blast output,
6 = tabular,
7 = tabular with comment lines,
8 = Text ASN.1,
9 = Binary ASN.1,
10 = Comma-separated values,
11 = BLAST archive format (ASN.1).

See NCBI Blast documentation for details. Use the ‘compressed’ parameter to return the XML output in compressed form. e.g. ‘?format=5&compressed=true’.

get_result_types(jobid)[source]

Get available result types for a finished job.

Parameters
  • jobid (str) – a job identifier returned by run().

  • verbose (bool) – print the identifiers together with their label, mediaTypes, description and filesuffix.

Returns

A dictionary, which keys correspond to the identifiers. Each identifier is itself a dictionary containing the label, description, file suffix and mediaType of the identifier.

get_status(jobid)[source]

Get status of a submitted job

Parameters
  • jobid (str) –

  • jobid – a job identifier returned by run().

Returns

A string giving the jobid status (e.g. FINISHED).

The values for the status are:

  • RUNNING: the job is currently being processed.

  • FINISHED: job has finished, and the results can then be retrieved.

  • ERROR: an error occurred attempting to get the job status.

  • FAILURE: the job failed.

  • NOT_FOUND: the job cannot be found.

property parameters
run(program=None, database=None, sequence=None, stype='protein', email=None, **kargs)[source]

Submit a job with the specified parameters.

Compulsary arguments

Parameters
  • program (str) – BLAST program to use to perform the search (e.g., blastp)

  • sequence (str) – query sequence. The use of fasta formatted sequence is recommended.

  • database (list) – list of database names for search or possible a single string (for one database). There are some mismatch between the output of parametersDetails(“database”) and the accepted values. For instance UniProt Knowledgebase should be given as “uniprotkb”.

  • email (str) – a valid email address. Will be checked by the service itself.

Optional arguments. If not provided, a default value will be used

Parameters
  • type (str) – query sequence type in ‘dna’, ‘rna’ or ‘protein’ (default is protein).

  • matrix (str) – scoring matrix to be used in the search (e.g., BLOSUM45).

  • gapalign (bool) – perform gapped alignments.

  • alignments (int) – maximum number of alignments displayed in the output.

  • exp – E-value threshold.

  • filter (bool) – low complexity sequence filter to process the query sequence before performing the search.

  • scores (int) – maximum number of scores displayed in the output.

  • dropoff (int) – amount score must drop before extension of hits is halted.

  • match_scores – match/miss-match scores to generate a scoring matrix for nucleotide searches.

  • gapopen (int) – penalty for the initiation of a gap.

  • gapext (int) – penalty for each base/residue in a gap.

  • seqrange – region of the query sequence to use for the search. Default: whole sequence.

Returns

A jobid that can be analysed with getResult(), getStatus(), …

The up to data values accepted for each of these parameters can be retrieved from the get_parameter_details().

For instance,:

from bioservices import NCBIblast
n = NCBIblast()
n.get_parameter_details("program")

Example:

jobid = n.run(program="blastp",
     sequence=n._sequence_example,
     stype="protein",
     database="uniprotkb",
     email="test@yahoo.fr")

Database can be a list of databases:

database=["uniprotkb", "uniprotkb_swissprot"]

The returned object is a jobid, which status can be checked. It must be finished before analysing/geeting the results.

See also

getResult()

Warning

Cases are not important. Spaces in the database case should be replaced by underscore.

Note

database returned by the server have meaningless names since they do not map to the expected names. An example is “ENA Sequence Release” that should be provided as em_rel

http://www.ebi.ac.uk/Tools/sss/ncbiblast/help/index-nucleotide.html

wait(jobId)[source]

This function checks the status of a jobid while it is running

Parameters
  • jobid (str) – a job identifier returned by run().

  • checkInterval (int) – interval between requests in seconds.

OmniPath Commons

Interface to OmniPath web service

What is OmniPath ?

URL

http://omnipathdb.org

URL

https://github.com/saezlab/pypath/blob/master/webservice.rst

A comprehensive collection of literature curated human signaling pathways.

—From OmniPath web site, March 2016

class OmniPath(verbose=False, cache=False)[source]

Interface to the OmniPath service

>>> from bioservices import OmniPath
>>> o = OmniPath()
>>> net = o.get_network()
>>> interactions = o.get_interactions('P00533')

Constructor OmniPath

Parameters

verbose – set to False to prevent informative messages

get_about()[source]

Information about the version

get_info()[source]

Currently returns HTML page

get_interactions(query='', frmt='json', fields=[])[source]

Interactions of proteins

Parameters
  • query (str) – a valid uniprot identifier (e.g. P00533). It can also be a list of uniprot identifiers, or a string with comma-separated identifiers.

  • fields (str) – additional fields to be added to the output (e.g., sources, references)

  • frmt (str) – format of the output (json or tabular)

Example:

res_one = o.get_interactions('P00533')
res_many = o.get_interactions('P00533,O15117,Q96FE5')
res_many = o.get_interactions(['P00533','O15117','Q96FE5'])

res_one = o.get_interactions('P00533', fields='sources')
res_one = o.get_interactions('P00533', fields=['source'])
res_one = o.get_interactions('P00533', fields=['source', 'references'])

You may also keep query to an empty string, but the entire DB will then be downloaded. This may take time and the timeout may need to be increased manually.

If frmt is set to TSV, the output is a TSV table with a header. If set to json, a dictionary is returned.

get_network(frmt='json')[source]

Get basic statistics about the whole network including sources

get_ptms(query='', ptm_type=None, frmt='json', fields=[])[source]

List enzymes, substrates and PTMs

Parameters
  • query (str) – a valid uniprot identifier (e.g. P00533). It can also be a list of uniprot identifiers, or a string with comma-separated identifiers.

  • ptm_type (str) – restrict the output to this type of PTM (e.g., phosphorylation)

  • fields (str) – additional fields to be added to the output (e.g., sources, references)

get_resources(frmt='json')[source]

Return statistics about the databases and their contents

Panther

Interface to some part of the Panther web service

What is Panther ?

URL

http://www.panther.org

Citation

The PANTHER (Protein ANalysis THrough Evolutionary Relationships) Classification System was designed to classify proteins (and their genes) in order to facilitate high-throughput analysis. Proteins have been classified according to:

  • Family and subfamily: families are groups of evolutionarily related proteins; subfamilies are related proteins that also have the same function

  • Molecular function: the function of the protein by itself or with directly interacting proteins at a biochemical level, e.g. a protein kinase

  • Biological process: the function of the protein in the context of a larger network of proteins that interact to accomplish a process at the level of the cell or organism, e.g. mitosis.

  • Pathway: similar to biological process, but a pathway also explicitly specifies the relationships between the interacting molecules.

—From PantherDB (about) , Feb 2020

class Panther(verbose=True, cache=False)[source]

Interface to Panther pages

>>> from bioservics import Panther
>>> p = Panther()
>>> p.get_supported_genomes()
>>> p.get_ortholog("zap70", 9606)

>>> from bioservics import Panther
>>> p = Panther()
>>> taxon = [x[0]['taxon_id'] for x in p.get_supported_genomes() if "coli" in x['name'].lower()]
>>> # you may also use our method called search_organism
>>> taxon = p.get_taxon_id(pattern="coli")
>>> res = p.get_mapping("abrB,ackA,acuI", taxon)

The get_mapping returns for each gene ID the GO terms corresponding to each ID. Those go terms may belong to different categories (see meth:get_annotation_datasets):

  • MF for molecular function

  • BP for biological process

  • PC for Protein class

  • CC Cellular location

  • Pathway

Note that results from the website application http://pantherdb.org/ do not agree with the oupput of the get_mapping service… Try out the dgt gene from ecoli for example

Constructor

Parameters

verbose – set to False to prevent informative messages

get_annotation_datasets()[source]

Retrieve the list of supported annotation data sets

get_enrichment(gene_list, organism, annotation, enrichment_test='Fisher', correction='FDR', ref_gene_list=None)[source]

Returns over represented genes

Compares a test gene list to a reference gene list, and determines whether a particular class (e.g. molecular function, biological process, cellular component, PANTHER protein class, the PANTHER pathway or Reactome pathway) of genes is overrepresented or underrepresented.

Parameters
  • organism – a valid taxon ID

  • enrichment_test – either Fisher or Binomial test

  • correction – correction for multiple testing. Either FDR, Bonferonni, or None.

  • annotation – one of the supported PANTHER annotation data types. See get_annotation_datasets() to retrieve a list of supported annotation data types

  • ref_gene_list – if not specified, the system will use all the genes for the specified organism. Otherwise, a list delimited by comma. Maximum of 100000 Identifiers can be any of the following: Ensemble gene identifier, Ensemble protein identifier, Ensemble transcript identifier, Entrez gene id, gene symbol, NCBI GI, HGNC Id, International protein index id, NCBI UniGene id, UniProt accession andUniProt id.

Returns

a dictionary with the following keys. ‘reference’ contains the orgnaism, ‘input_list’ is the input gene list with unmapped genes. ‘result’ contains the list of candidates.

>>> from bioservices import Panther
>>> p = Panther()
>>> res = p.get_enrichment('zap70,mek1,erk', 9606, "GO:0008150")
>>> For molecular function, use :
>>> res = p.get_enrichment('zap70,mek1,erk', 9606,
        "ANNOT_TYPE_ID_PANTHER_GO_SLIM_MF")
get_family_msa(family, taxon_list=None)[source]

Returns MSA information for the specified family.

Parameters
  • family – family ID

  • taxon_list – Zero or more taxon IDs separated by ‘,’.

get_family_ortholog(family, taxon_list=None)[source]

Search for matching orthologs in target organisms

Also return the corresponding position in the target organism sequence. The system searches for matching orthologs in the gene family that contains the search gene associated with the search term.

Parameters
  • family – Family ID

  • taxon_list – Zero or more taxon IDs separated by ‘,’.

get_homolog_position(gene, organism, position, ortholog_type='all')[source]
Parameters
  • gene – Can be any of the following: Ensemble gene identifier, Ensemble protein identifier, Ensemble transcript identifier, Entrez gene id, gene symbol, NCBI GI, HGNC Id, International protein index id, NCBI UniGene id, UniProt accession andUniProt id

  • organism – a valid taxon ID

  • ortholog_type – optional parameter to specify ortholog type of target organism

get_mapping(gene_list, taxon)[source]

Map identifiers

Each identifier to be delimited by comma i.e. ‘,. Maximum of 1000 Identifiers can be any of the following: Ensemble gene identifier, Ensemble protein identifier, Ensemble transcript identifier, Entrez gene id, gene symbol, NCBI GI, HGNC Id, International protein index id, NCBI UniGene id, UniProt accession and UniProt id

Parameters

If an identifier is not found, information can be found in the unmapped_genes key while found identifiers are in the mapped_genes key.

Warning

found and not found identifiers are dispatched into unmapped and mapped genes. If there are not found identifiers, the input gene list and the mapped genes list do not have the same length. The input names are not stored in the output. Developpers should be aware of that feature.

get_ortholog(gene_list, organism, target_organism=None, ortholog_type='all')[source]

search for matching orthologs in target organisms.

Searches for matching orthologs in the gene family that contains the search gene associated with the search terms. Returns ortholog genes in target organisms given a search organism, the search terms and a list of target organisms.

Parameters
  • gene_list

  • organism – a valid taxon ID

  • target_organism – zero or more taxon IDs separated by ‘,’. See get_supported_genomes()

  • ortholog_type – optional parameter to specify ortholog type of target organism

Returns

a dictionary with “mapped” and “unmapped” keys, each of them being a list. For each unmapped gene, a dictionary with id and organism is is returned. For the mapped gene, a list of ortholog is returned.

get_pathways()[source]

Returns all pathways from pantherdb

get_supported_families(N=1000, progress=True)[source]

Returns the list of supported PANTHER family IDs

This services returns only 1000 items per request. This is defined by the index. For instance index set to 1 returns the first 1000 families. Index set to 2 returns families between index 1000 and 2000 and so on. As of 20 Feb 2020, there was about 15,000 families.

This function simplifies your life by calling the service as many times as required. Therefore it returns all families in one go.

get_supported_genomes(type=None)[source]

Returns list of supported organisms.

Parameters

type – can be chrLoc to restrict the search

get_taxon_id(pattern=None)[source]

return all taxons supported by the service

If pattern is provided, we filter the name to keep those that contain the filter. If only one is found, we return the name itself, otherwise a list of candidates

get_tree_info(family, taxon_list=None)[source]

Returns tree topology information and node attributes for the specified family.

Parameters
  • family – Family ID

  • taxon_list – Zero or more taxon IDs separated by ‘,’.

Pathway Commons

This module provides a class PathwayCommons

What is PathwayCommons ?

URL

http://www.pathwaycommons.org/about

REST

Pathway Commons is a convenient point of access to biological pathway information collected from public pathway databases, which you can search, visualize and download. All data is freely available, under the license terms of each contributing database.

—PathwayCommons home page, Nov 2013

Data is freely available, under the license terms of each contributing database.

class PathwayCommons(verbose=True, cache=False)[source]

Interface to the PathwayCommons service

>>> from bioservices import *
>>> pc2 = PathwayCommons(verbose=False)
>>> res = pc2.get("http://identifiers.org/uniprot/Q06609")

Todo

traverse() method not implemented.

Constructor

Parameters

verbose (bool) – prints informative messages

property default_extension

set extension of the requests (default is json). Can be ‘json’ or ‘xml’

get(uri, frmt='BIOPAX')[source]

Retrieves full pathway information for a set of elements

elements can be for example pathway, interaction or physical entity given the RDF IDs. Get commands only retrieve the BioPAX elements that are directly mapped to the ID. Use the traverse() query to traverse BioPAX graph and obtain child/owner elements.

Parameters
  • uri (str) – valid/existing BioPAX element’s URI (RDF ID; for utility classes that were “normalized”, such as entity refereneces and controlled vocabularies, it is usually a Identifiers.org URL. Multiple IDs can be provided using list uri=[http://identifiers.org/uniprot/Q06609, http://identifiers.org/uniprot/Q549Z0’] See also about MIRIAM and Identifiers.org.

  • format (str) – output format (values)

Returns

a complete BioPAX representation for the record pointed to by the given URI is returned. Other output formats are produced by converting the BioPAX record on demand and can be specified by the optional format parameter. Please be advised that with some output formats it might return “no result found” error if the conversion is not applicable for the BioPAX result. For example, BINARY_SIF output usually works if there are some interactions, complexes, or pathways in the retrieved set and not only physical entities.

>>> from bioservices import PathwayCommons
>>> pc2 = PathwayCommons(verbose=False)
>>> res = pc2.get("col5a1")
>>> res = pc2.get("http://identifiers.org/uniprot/Q06609")
get_sifgraph_common_stream(source, limit=1, direction='DOWNSTREAM', pattern=None)[source]

finds the common stream for them; extracts a sub-network from the loaded Pathway Commons SIF model.

Parameters
  • source – set of gene identifiers (HGNC symbol). Can be a list of identifiers or just one string(if only one identifier)

  • limit (int) – Graph traversal depth. Limit > 1 value can result in very large data or error.

  • direction (str) – Graph traversal direction. Use UNDIRECTED if you want to see interacts-with relationships too.

  • pattern (str) – Filter by binary relationship (SIF edge) type(s). one of “BOTHSTREAM”, “UPSTREAM”, “DOWNSTREAM”, “UNDIRECTED”.

returns: the graph in SIF format. The output must be stripped and

returns one line per relation. In each line, items are separated by a tabulation. You can save the text with .sif extensions and it should be ready to use e.g. in cytoscape viewer.

res = pc.get_sifgraph_common_stream(['BRD4', 'MYC'])
get_sifgraph_neighborhood(source, limit=1, direction='BOTHSTREAM', pattern=None)[source]

finds the neighborhood sub-network in the Pathway Commons Simple Interaction Format (extented SIF) graph (see http://www.pathwaycommons.org/pc2/formats#sif)

Parameters
  • source – set of gene identifiers (HGNC symbol). Can be a list of identifiers or just one string(if only one identifier)

  • limit (int) – Graph traversal depth. Limit > 1 value can result in very large data or error.

  • direction (str) – Graph traversal direction. Use UNDIRECTED if you want to see interacts-with relationships too.

  • pattern (str) – Filter by binary relationship (SIF edge) type(s). one of “BOTHSTREAM”, “UPSTREAM”, “DOWNSTREAM”, “UNDIRECTED”.

returns: the graph in SIF format. The output must be stripped and

returns one line per relation. In each line, items are separated by a tabulation. You can save the text with .sif extensions and it should be ready to use e.g. in cytoscape viewer.

res = pc.get_sifgraph_neighborhood('BRD4')
get_sifgraph_pathsbetween(source, limit=1, directed=False, pattern=None)[source]

finds the paths between them; extracts a sub-network from the Pathway Commons SIF graph.

Parameters
  • source – set of gene identifiers (HGNC symbol). Can be a list of identifiers or just one string(if only one identifier)

  • limit (int) – Graph traversal depth. Limit > 1 value can result in very large data or error.

  • directed (bool) – Directionality: ‘true’ is for DOWNSTREAM/UPSTREAM, ‘false’ - UNDIRECTED

  • pattern (str) – Filter by binary relationship (SIF edge) type(s). one of “BOTHSTREAM”, “UPSTREAM”, “DOWNSTREAM”, “UNDIRECTED”.

returns: the graph in SIF format. The output must be stripped and

returns one line per relation. In each line, items are separated by a tabulation. You can save the text with .sif extensions and it should be ready to use e.g. in cytoscape viewer.

get_sifgraph_pathsfromto(source, target, limit=1, pattern=None)[source]

finds the paths between them; extracts a sub-network from the Pathway Commons SIF graph.

Parameters

source – set of gene identifiers (HGNC symbol). Can be a list of identifiers or just one string(if only one identifier)

param target: A target set of gene identifiers. :param int limit: Graph traversal depth. Limit > 1 value can result

in very large data or error.

Parameters

pattern (str) – Filter by binary relationship (SIF edge) type(s). one of “BOTHSTREAM”, “UPSTREAM”, “DOWNSTREAM”, “UNDIRECTED”.

returns: the graph in SIF format. The output must be stripped and

returns one line per relation. In each line, items are separated by a tabulation. You can save the text with .sif extensions and it should be ready to use e.g. in cytoscape viewer.

graph(kind, source, target=None, direction=None, limit=1, frmt=None, datasource=None, organism=None)[source]

Finds connections and neighborhoods of elements

Connections can be for example the shortest path between two proteins or the neighborhood for a particular protein state or all states.

Graph searches take detailed BioPAX semantics such as generics or nested complexes into account and traverse the graph accordingly. The starting points can be either physical entites or entity references.

In the case of the latter the graph search starts from ALL the physical entities that belong to that particular entity references, i.e. all of its states. Note that we integrate BioPAX data from multiple databases based on our proteins and small molecules data warehouse and consistently normalize UnificationXref, EntityReference, Provenance, BioSource, and ControlledVocabulary objects when we are absolutely sure that two objects of the same type are equivalent. We, however, do not merge physical entities and reactions from different sources as matching and aligning pathways at that level is still an open research problem. As a result, graph searches can return several similar but disconnected sub-networks that correspond to the pathway data from different providers (though some physical entities often refer to the same small molecule or protein reference or controlled vocabulary).

Parameters
  • kind (str) – graph query

  • source (str) – source object’s URI/ID. Multiple source URIs/IDs must be encoded as list of valid URI source=[‘http://identifiers.org/uniprot/Q06609’, ‘http://identifiers.org/uniprot/Q549Z0’].

  • target (str) – required for PATHSFROMTO graph query. target URI/ID. Multiple target URIs must be encoded as list (see source parameter).

  • direction (str) – graph search direction in [BOTHSTREAM, DOWNSTREAM, UPSTREAM] see _valid_directions attribute.

  • limit (int) – graph query search distance limit (default = 1).

  • format (str) – output format. see _valid-format

  • datasource (str) – datasource filter (same as for ‘search’).

  • organism (str) – organism filter (same as for ‘search’).

Returns

By default, graph queries return a complete BioPAX representation of the subnetwork matched by the algorithm. Other output formats are available as specified by the optional format parameter. Please be advised that some output format choices might cause “no result found” error if the conversion is not applicable for the BioPAX result (e.g., BINARY_SIF output fails if there are no interactions, complexes, nor pathways in the retrieved set).

>>> from bioservices import PathwayCommons
>>> pc2 = PathwayCommons(verbose=False)
>>> res = pc2.graph(source="http://identifiers.org/uniprot/P20908",
        kind="neighborhood", format="EXTENDED_BINARY_SIF")
search(q, page=0, datasource=None, organism=None, type=None)[source]

Text search in PathwayCommons using Lucene query syntax

Some of the parameters are BioPAX properties, others are composite relationships.

All index fields are (case-sensitive): comment, ecnumber, keyword, name, pathway, term, xrefdb, xrefid, dataSource, and organism.

The pathway field maps to all participants of pathways that contain the keyword(s) in any of its text fields.

Finally, keyword is a transitive aggregate field that includes all searchable keywords of that element and its child elements.

All searches can also be filtered by data source and organism.

It is also possible to restrict the domain class using the ‘type’ parameter.

This query can be used standalone or to retrieve starting points for graph searches.

Parameters
  • q (str) – requires a keyword , name, external identifier, or a Lucene query string.

  • page (int) – (N>=0, default is 0), search result page number.

  • datasource (str) – filter by data source (use names or URIs of pathway data sources or of any existing Provenance object). If multiple data source values are specified, a union of hits from specified sources is returned. datasource=[reactome,pid] returns hits associated with Reactome or PID.

  • organism (str) – The organism can be specified either by official name, e.g. “homo sapiens” or by NCBI taxonomy id, e.g. “9606”. Similar to data sources, if multiple organisms are declared a union of all hits from specified organisms is returned. For example organism=[9606, 10016] returns results for both human and mice.

  • type (str) – BioPAX class filter. (e.g., ‘pathway’, ‘proteinreference’)

>>> from bioservices import PathwayCommons
>>> pc2 = PathwayCommons(vverbose=False)
>>> pc2.search("Q06609")
>>> pc2.search("brca2", type="proteinreference",
        organism="homo sapiens",  datasource="pid")
>>> pc2.search("name:'col5a1'", type="proteinreference", organism=9606)
>>> pc2.search("a*", page=3)

Find the FGFR2 keyword:

pc2.search("FGFR2")

Find pathways by FGFR2 keyword in any index field.:

pc2.search("FGFR2", type="pathway")

Finds control interactions that contain the word binding but not transcription in their indexed fields:

pc2.search("binding NOT transcription", type="control")

Find all interactions that directly or indirectly participate in a pathway that has a keyword match for “immune” (Note the star after immune):

pc.search(“pathway:immune*”, type=”conversion”)

Find all Reactome pathways:

pc.search("*", type="pathway", datasource="reactome")
top_pathways(query='*', datasource=None, organism=None)[source]

This command returns all top pathways

Pathways can be top or pathways that are neither ‘controlled’ nor ‘pathwayComponent’ of another process.

param query

a keyword, name, external identifier or lucene query string like in ‘search’. Default is “*”

param str datasource

filter by data source (same as search)

param str organism

organism filter. 9606 for human.

return

dictionary with information about top pathways. Check the “searchHit” key for information about “dataSource” for instance

>>> from bioservices import PathwayCommons
>>> pc2 = PathwayCommons(verbose=False)
>>> res = pc2.top_pathways()

https://www.pathwaycommons.org/pc2/top_pathways?q=TP53

traverse(uri, path)[source]

Provides XPath-like access to the PC.

The format of the path query is in the form:

[InitialClass]/[property1]:[classRestriction(optional)]/[property2]... A "*"

sign after the property instructs path accessor to transitively traverse that property. For example, the following path accessor will traverse through all physical entity components within a complex:

"Complex/component*/entityReference/xref:UnificationXref"

The following will list display names of all participants of interactions, which are components (pathwayComponent) of a pathway (note: pathwayOrder property, where same or other interactions can be reached, is not considered here):

"Pathway/pathwayComponent:Interaction/participant*/displayName"

The optional parameter classRestriction allows to restrict/filter the returned property values to a certain subclass of the range of that property. In the first example above, this is used to get only the Unification Xrefs. Path accessors can use all the official BioPAX properties as well as additional derived classes and parameters in paxtools such as inverse parameters and interfaces that represent anonymous union classes in OWL. (See Paxtools documentation for more details).

Parameters
  • uri (str) – a biopax element URI - specified similar to the ‘GET’ command. multiple IDs are allowed as a list of strings.

  • path (str) – a BioPAX propery path in the form of property1[:type1]/property2[:type2]; see above, inverse properties, Paxtools, org.biopax.paxtools.controller.PathAccessor.

See also

properties

Returns

XML result that follows the Search Response XML Schema (TraverseResponse type; pagination is disabled: returns all values at once)

from bioservices import PathwayCommons
pc2 = PathwayCommons(verbose=False)
res = pc2.traverse(uri=['http://identifiers.org/uniprot/P38398','http://identifiers.org/uniprot/Q06609'], path="ProteinReference/organism")
res = pc2.traverse(uri="http://identifiers.org/uniprot/Q06609",
    path="ProteinReference/entityReferenceOf:Protein/name")
res = pc2.traverse("http://identifiers.org/uniprot/P38398",
    path="ProteinReference/entityReferenceOf:Protein")
res = pc2.traverse(uri=["http://identifiers.org/uniprot/P38398",
    "http://identifiers.org/taxonomy/9606"], path="Named/name")
PDB/PDBe modules

Interface to the PDB web Service (New API Jan 2021).

What is PDB ?

URL

http://www.rcsb.org/pdb/

REST

http://search.rcsb.org/#search-api

An Information Portal to Biological Macromolecular Structures

—PDB home page, Jan 2021

class PDB(verbose=False, cache=False)[source]

Interface to PDB service (new API Jan 2021)

With the new API, one method called search() is provided by PDB. To perform a search you need to define a query. Here is an example

>>> from bioservices import PDB
>>> s = PDB()
>>> query = {"query":
...              {"type": "terminal",
...               "service": "text",
...               "parameters": {
...                 "value": "thymidine kinase"
...                 }
...             },
...          "return_type": "entry"}
>>> res = s.search(query, return_type=return_type)

Note

as of December 2020, a new API has be set up by PDB. some prevous functionalities such as return list of Ligand are not supported anymore (Jan 2021). However, many more powerful searches as available. I encourage everyone to look at the PDB page for complex examples: http://search.rcsb.org/#examples

As mentionnaed above, the PDB service provide one method called search available in search(). We will not cover all the power and capability of this search function. User should refer to the official PDB help for that. Yet, given examples from PDB should all work with this method.

When possible, we will add convenient aliases function in this class. For now we have for example the get_current_ids() and get_similarity_sequence() that users may find useful.

The main idea behind the PDB API is to create queries that can access to different type of services. A query will need to at least two keys:

  • query

  • return_type

Consider this basic example that searches for the text thymidine kinase:

{
  "query": {
    "type": "terminal",
    "service": "text",
    "parameters": {
      "value": "thymidine kinase"
    }
  },
  "return_type": "entry"
}

Here the query is defined by a query and a return_type indeed. The return type is a simple value such as entry. The query itself is composed of 3 pairs of key/value. Here we have the type service and parameters as defined below.

The query can have several fields:

  • type: the clause type can be either terminal or group

    • terminal: performs an atomic search operation, e.g. searches for a particular value in a particular field.

    • group: wraps other terminal or group nodes and is used to combine multiple queries in a logical fashion.

  • service:

    • text: linguistic searches against textual annotations.

    • sequence: uses MMSeq2 to perform sequence matching searches (blast-like). following targets that are available:

      • pdb_protein_sequence,

      • pdb_dna_sequence,

      • pdb_na_sequence

    • seqmotif: performs short motif searches against nucleotide or protein sequences using 3 different inputs:

      • simple (e.g., CXCXXL)

      • prosite (e.g., C-X-C-X(2)-[LIVMYFWC])

      • regex (e.g., CXCX{2}[LIVMYFWC])

    • structure: searches matching a global 3D shape of assemblies or chains of a given entry (identified by PDB ID), in either strict (strict_shape_match) or relaxed (relaxed_shape_match) modes

    • strucmotif: Performs structural motif searches on all available PDB structures.

    • chemical: queries of small-molecule constituents of PDB structures, based on chemical formula and chemical structure. Queries for matching and similar chemical structures can be performed using SMILES and InChI descriptors as search targets.

      • graph-strict: atom type, formal charge, bond order, atom and bond chirality, aromatic assignment are used as matching criteria for this search type.

      • graph-relaxed: atom type, formal charge and bond order are used as matching criteria for this search type.

      • graph-relaxed-stereo: atom type, formal charge, bond order, atom and bond chirality are used as matching criteria for this search type.

      • fingerprint-similarity: Tanimoto similarity is used as the matching criteria

Concerning the return_type key, it can be one of :

  • entry: a list of PDB IDs.

  • assembly: list of PDB IDs appended with assembly IDs in the format of a [pdb_id]-[assembly_id], corresponding to biological assemblies.

  • polymer_entity: list of PDB IDs appended with entity IDs in the format of a [pdb_id]_[entity_id], corresponding to polymeric molecular entities.

  • non_polymer_entity: list of PDB IDs appended with entity IDs in the format of a [pdb_id]_[entity_id], corresponding to non-polymeric entities (or ligands).

  • polymer_instance: list of PDB IDs appended with asym IDs in the format of a [pdb_id].[asym_id], corresponding to instances of certain polymeric molecular entities, also known as chains.

Optional arguments

There are many optional arguments. Let us see a couple of them. Pagination can be set (default is 10 entries) using the request_options (optional) key. Consider this query example:

{
  "query": {
    "type": "terminal",
    "service": "text",
    "parameters": {
        "attribute": "rcsb_polymer_entity.formula_weight",
        "operator": "greater",
        "value": 500
    }
  },
  "request_options": {
    "pager": {
      "start": 0,
      "rows": 100
    }
  },
  "return_type": "polymer_entity"
}

Here, the query searches for the polymer_entity that have a formula weight above 500. Withe request_options pager set to 100, we will get the first 100 hits.

To return all hits, set this field in the request_options:

"return_all_hits": true

Coming back at the first basic example, we can reuse it to illustrate how to refine the search using attribute and operators:

{
  "query": {
    "type": "terminal",
    "service": "text",
    "parameters": {
      "value": "thymidine kinase",
      "attribute": "exptl.method",
      "operator": "exact_match",
    }
  },
  "return_type": "entry"
}

All valid combo of operators and attributes can be found here: http://search.rcsb.org/search-attributes.html

For instance, in the example above only in, exact_match and exists can be used with exptl.method attribute. This is not checked in bioservices.

Sorting is determined by the sort object in the request_options context. It allows you to add one or more sorting conditions to control the order of the search result hits. The sort operation is defined on a per field level, with special field name for score to sort by score (the default)<

By default sorting is done in descending order (“desc”). The sort can be reversed by setting direction property to “asc”. This example demonstrates how to sort the search results by release date:

{
  "query": {
    "type": "terminal",
    "service": "text",
    "parameters": {
      "attribute": "struct.title",
      "operator": "contains_phrase",
      "value": ""hiv protease""
    }
  },
  "request_options": {
    "sort": [
      {
        "sort_by": "rcsb_accession_info.initial_release_date",
        "direction": "desc"
      }
    ]
  },
  "return_type": "entry"
}

Again, many more complex examples can be found on PDB page.

Constructor

Parameters

verbose (bool) – prints informative messages (default is off)

get_current_ids()[source]

Get a list of all current PDB IDs.

get_similarity_sequence(seq)[source]

Search of seauence similarity search with protein sequence

seq = “VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTAVAHVDDMPNAL” results = p.get_similarity_sequence(seq)

search(query, request_options=None, request_info=None, return_type=None)[source]

search request represented as a JSON object.

This is the only function in PDB API. You should be able to perform any valid PDB searches here (see the bioservices.pdb.PDB documentation for details. Note, however, that we have aliases methods in BioServices that will be added on demand for common searches.

Parameters
  • query (str) – the search expression. Can be omitted if, instead of IDs retrieval, facets or count operation should be performed. In this case the request must be configured via the request_options context.

  • request_options (str) – (optional) controls various aspects of the search request including pagination, sorting, scoring and faceting.

  • request_info (str) – additional information about the query, e.g. query_id. (optional)

  • return_type (str) – type of results to return.

Returns

json results

You must define a query as defined in the PDB web page. For example the following query search for macromolecular PDB entities that share 90% sequence identity with GTPase HRas protein from Gallus gallus (Chicken):

query = {
  "query": {
    "type": "terminal",
    "service": "sequence",
    "parameters": {
      "evalue_cutoff": 1,
      "identity_cutoff": 0.9,
      "target": "pdb_protein_sequence",
      "value": "MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLPARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMNCKCVIS"
    }
  },
  "request_options": {
    "scoring_strategy": "sequence"
  },
  "return_type": "polymer_entity"
}

What is important is that the dictionary called query contains 2 compulsary keys namely query and return_type. The two other optional keys are request_options and return_info

You would then call the PDB search as follows:

from bioservices import PDB
p = PDB()
results = p.search(query)

Now, in BioServices, you can also decompose the query as follows:

query = {
    "type": "terminal",
    "service": "sequence",
    "parameters": {
      "evalue_cutoff": 1,
      "identity_cutoff": 0.9,
      "target": "pdb_protein_sequence",
      "value": "MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLPARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMNCKCVIS"
    }}
request_options =  { "scoring_strategy": "sequence"}
return_type= "polymer_entity"

and then use PDB search again:

from bioservices import PDB
p = PDB()
results = p.search(query, request_options=request_options, return_type=return_type)

or even simpler for the Pythonic lovers:

results = p.search(**query)

Interface to the PDBe web Service.

What is PDBe ?

URL

https://www.ebi.ac.uk/pdbe/

REST

https://www.ebi.ac.uk/pdbe/api/doc/

PDBe is a founding member of the Worldwide Protein Data Bank which collects, organises and disseminates data on biological macromolecular structures. In collaboration with the other Worldwide Protein Data Bank (wwPDB) partners, we work to collate, maintain and provide access to the global repository of macromolecular structure models, the Protein Data Bank (PDB).

—PDBe home page, June 2020

class PDBe(verbose=False, cache=False)[source]

Interface to part of the PDBe service

>>> from bioservices import PDBe
>>> s = PDBe()
>>> res = s.get_file("1FBV", "pdb")

Constructor

Parameters

verbose (bool) – prints informative messages (default is off)

get_assembly(query)[source]

Provides information for each assembly of a given PDB ID. T

This information is broken down at the entity level for each assembly. The information given includes the molecule name, type and class, the chains where the molecule occur, and the number of copies of each entity in the assembly.

Parameters

query – a 4-character PDB id code

p.get_assembly('1cbs')
get_binding_sites(query)[source]

Pprovides details on binding sites in the entry

STRUCT_SITE records in PDB files (or mmcif equivalent thereof), such as ligand, residues in the site, description of the site, etc.

Parameters

query – a 4-character PDB id code

p.get_binding_sites('1cbs')
get_drugbank_annotation(query)[source]

This call provides DrugBank annotation of all ligands, i.e. ‘bound’

Parameters

query – a 4-character PDB id code

p.get_drugbank_annotation('5hht')
get_electron_density_statistics(query)[source]

This call details the statistics for electron density.

Parameters

query – a 4-character PDB id code

p.get_electron_density_statistics('1cbs')
get_experiment(query)[source]

Provides details of experiment(s) carried out in determining the structure of the entry.

Each experiment is described in a separate dictionary. For X-ray diffraction, the description consists of resolution, spacegroup, cell dimensions, R and Rfree, refinement program, etc. For NMR, details of spectrometer, sample, spectra, refinement, etc. are included. For EM, details of specimen, imaging, acquisition, reconstruction, fitting etc. are included.

Parameters

query – a 4-character PDB id code

p.get_experiment('1cbs')
get_files(query)[source]

Provides URLs and brief descriptions (labels) for PDB entry

Also, for mmcif files, biological assembly files, FASTA file for sequences, SIFTS cross reference XML files, validation XML files, X-ray structure factor file, NMR experimental constraints files, etc.

Parameters

query – a 4-character PDB id code

p.get_files('1cbs')
get_functional_annotation(query)[source]

Provides functional annotation of all ligands, i.e. ‘bound’

Parameters

query – a 4-character PDB id code

p.get_functional_annotation('1cbs')
get_ligand_monomers(query)[source]

Provides a a list of modelled instances of ligands,

ligands i.e. ‘bound’ molecules that are not waters.

Parameters

query – a 4-character PDB id code

p.get_ligand_monomers('1cbs')
get_modified_residues(query)[source]

Provides a list of modelled instances of modified amino acids or nucleotides in protein, DNA or RNA chains.

Parameters

query – a 4-character PDB id code

p.get_modified_residues('4v5j')
get_molecules(query)[source]

Return details of molecules (or entities in mmcif-speak) modelled in the entry

This can be entity id, description, type, polymer-type (if applicable), number of copies in the entry, sample preparation method, source organism(s) (if applicable), etc.

Parameters

query – a 4-character PDB id code

p.get_molecules('1cbs')
get_mutated_residues(query)[source]

Provides a list of modelled instances of mutated amino acids or nucleotides in protein, DNA or RNA chains.

Parameters

query – a 4-character PDB id code

p.get_mutated_residues('1bgj')
get_nmr_resources(query)[source]

This call provides URLs of available additional resources for NMR entries. E.g., mapping between structure (PDB) and chemical shift (BMRB) entries. :param query: a 4-character PDB id code

p.get_nmr_resources('1cbs')
get_observed_ranges(query)[source]
Provides observed ranges, i.e., segments of structural coverage of

polymeric molecues that are modelled fully or partly

Parameters

query – a 4-character PDB id code

p.get_observed_ranges('1cbs')
get_observed_ranges_in_pdb_chain(query, chain_id)[source]
Provides observed ranges, i.e., segments of structural coverage of

polymeric molecules in a particular chain

Parameters
  • query – a 4-character PDB id code

  • query – a PDB chain ID

p.get_observed_ranges_in_pdb_chain('1cbs', "A")
get_observed_residues_ratio(query)[source]

Provides the ratio of observed residues for each chain in each molecule

The list of chains within an entity is sorted by observed_ratio (descending order),

partial_ratio (ascending order), and number_residues (descending order).

Parameters

query – a 4-character PDB id code

p.get_observed_residues_ratio('1cbs')

Provides DOI’s for related raw experimental datasets

Includes diffraction image data, small-angle scattering data and electron micrographs.

Parameters

query – a 4-character PDB id code

p.get_cofactor('5o8b')

Return publications obtained from both EuroPMC and UniProt. T

These are articles which cite the primary citation of the entry, or open-access articles which mention the entry id without explicitly citing the primary citation of an entry.

Parameters

query – a 4-character PDB id code

p.get_related_publications('1cbs')
get_release_status(query)[source]

Provides status of a PDB entry (released, obsoleted, on-hold etc) along with some other information such as authors, title, experimental method, etc.

Parameters

query – a 4-character PDB id code

p.get_release_status('1cbs')
get_residue_listing(query)[source]

Provides lists all residues (modelled or otherwise) in the entry.

Except waters, along with details of the fraction of expected atoms modelled for the residue and any alternate conformers.

Parameters

query – a 4-character PDB id code

p.get_residue_listing('1cbs')
get_residue_listing_in_pdb_chain(query, chain_id)[source]

Provides all residues (modelled or otherwise) in the entry

Except waters, along with details of the fraction of expected atoms modelled for the residue and any alternate conformers.

Parameters
  • query – a 4-character PDB id code

  • query – a PDB chain ID

p.get_residue_listing_in_pdb_chain('1cbs')
get_secondary_structure(query)[source]

Provides residue ranges of regular secondary structure

(alpha helices and beta strands) found in protein chains of the entry. For strands, sheet id can be used to identify a beta sheet.

Parameters

query – a 4-character PDB id code

p.get_secondary_structure('1cbs')
get_summary(query)[source]

Returns summary of a PDB entry

This can be title of the entry, list of depositors, date of deposition, date of release, date of latest revision, experimental method, list of related entries in case split entries, etc.

Parameters

query – a 4-character PDB id code

p.get_summary('1cbs')
p.get_summary('1cbs,2kv8')
p.get_summary(['1cbs', '2kv8'])
PRIDE module

Interface to PRIDE web service

What is PRIDE ?

URL

http://www.ebi.ac.uk/pride/ws/archive/v2

The PRIDE PRoteomics IDEntifications database is a centralized, standards compliant, public data repository for proteomics data, including protein and peptide identifications, post-translational modifications and supporting spectral evidence.

—From PRIDE web site, Jan 2015

class PRIDE(verbose=False, cache=False)[source]

Interface to the PRIDE service

from bioservices import PRIDE
p = PRIDE()
p.get_peptide_evidence(projectAccession)

Changed in version 1.10.1: Due to new API:

  • the method project_count was dropped.

  • get_project_list was renamed in get_project_files

  • get_assays, get_assay_count, get_assay_count_project_accession, get_assay_list were dropped in v2

  • get_protein_list, get_protein_count, get_protein_count_assay, get_protein_list, get_protein_list_assay replaced by get_protein_evidences method

  • get_peptide_list_assay, get_peptide_count, get_peptide_list, get_peptide_list_sequence, get_peptide_count_assay replaced by get_peptide_evidence.

Constructor

Parameters
  • verbose – set to False to prevent informative messages

  • cache – set to True to use caching. Not recommended for this service that evolves a lot

get_peptide_evidence(project_accession=None, assay_accession=None, protein_accession=None, peptide_evidence_accession=None, peptide_sequence=None, pageSize=100, page=0, sortDirection='DESC', sortConditions='projectAccession')[source]

Get all the peptide evidences for an specific protein evidence

Parameters
  • project_accession

  • assay_accession

  • protein_accession

  • peptide_evidence_accession

  • peptide_sequence

  • pageSize (int) – how many results to return per page

  • page (int) – which page (starting from 0) of the result to return

  • sortConditions (str) – default is submission_date but more fields can be separated by comma and passed. Example: submission_date,project_title

  • sortDirection (str) – the sorting order (ASC or DESC)

Retrieving data from project accession should be fast:

p.get_peptide_evidence(protein_accession="Q8IX30")

but other methods may be slow:

p.get_peptide_evidence(peptide_sequence="CQGSPGASKAMLSCNR")
get_project(identifier)[source]

Retrieve project information by accession

List of PRIDE Archive Projects. The following method do not allows to perform search, for search functionality you will need to use the search/projects. The result list is Paginated using the pageSize and page.

Parameters

identifier (str) – a valid PRIDE identifier e.g., PRD000001

Returns

if identifier is invalid, returns an emppty dictionary {}

>>> from bioservices import PRIDE
>>> p = PRIDE()
>>> res = p.get_project("PRD000001")
>>> res['title']
'COFRADIC proteome of unstimulated human blood platelets'
get_project_files(accession, pageSize=100, page=0, sortConditions=None, sortDirection='DESC', filters='')[source]

list projects or given criteria

Parameters
  • accession (str) – the accession number to look for

  • pageSize (int) – how many results to return per page

  • page (int) – which page (starting from 0) of the result to return

  • sortConditions (str) – default is submission_date but more fields can be separated by comma and passed. Example: submission_date,project_title

  • sortDirection (str) – the sorting order (ASC or DESC)

  • filters (str) – Parameters to filter the search results. The structure of the filter is: field1==value1, field2==value2. Example accession==PRD000001

>>> p = PRIDE()
>>> results = p.get_project_files(accession="PRD000001", pageSize=10, page=1)

In v1.10.1 due to new PRIDE API, the method get_file_count was dropped. You can use:

len(results['_embedded']['files'])

Similarly the get_file_list method was dropped since all results are stored in the output of this method

get_projects(pageSize=100, max_pages=1000000000.0)[source]

Get list of all projects

get_projects_count()[source]
get_protein_evidences(project_accession=None, assay_accession=None, reported_accession=None, pageSize=100, page=0, sortDirection='DESC', sortConditions='projectAccession')[source]

Get all proteins evidence

Parameters
  • project_accession

  • assay_accession

  • reported_accession

  • pageSize (int) – how many results to return per page

  • page (int) – which page (starting from 0) of the result to return

  • sortConditions (str) – default is submission_date but more fields can be separated by comma and passed. Example: submission_date,project_title

  • sortDirection (str) – the sorting order (ASC or DESC)

p.get_protein_evidences()['_embedded']['proteinevidences']
get_stats(name=None)[source]

Retrieve statistics by Name

If you do not have the name, just type:

p.get_stats()

and then, e.g.,

p.get_stats("SUBMISSIONS_PER_YEAR")
PSICQUIC

Interface to the PSICQUIC web service

What is PSICQUIC ?

URL

http://code.google.com/p/psicquic/

REST

http://code.google.com/p/psicquic/wiki/PsicquicSpec_1_3_Rest

“PSICQUIC is an effort from the HUPO Proteomics Standard Initiative (HUPO-PSI) to standardise the access to molecular interaction databases programmatically. The PSICQUIC View web interface shows that PSICQUIC provides access to 25 active service “

—Dec 2012

About queries

source: PSICQUIC View web page

The idea behind PSICQUIC is to retrieve information related to protein interactions from various databases. Note that protein interactions does not necesseraly mean protein-protein interactions. In order to be effective, the query format has been standarised.

To do a search you can use the Molecular Interaction Query Language which is based on Lucene’s syntax. Here are some rules

  • Use OR or space ‘ ‘ to search for ANY of the terms in a field

  • Use AND if you want to search for those interactions where ALL of your terms are found

  • Use quotes (”) if you look for a specific phrase (group of terms that must be searched together) or terms containing special characters that may otherwise be interpreted by our query engine (eg. ‘:’ in a GO term)

  • Use parenthesis for complex queries (e.g. ‘(XXX OR YYY) AND ZZZ’)

  • Wildcards (*,?) can be used between letters in a term or at the end of terms to do fuzzy queries,

    but never at the beginning of a term.

  • Optionally, you can prepend a symbol in front of your term.
      • (plus): include this term. Equivalent to AND. e.g. +P12345

      • (minus): do not include this term. Equivalent to NOT. e.g. -P12345

    • Nothing in front of the term. Equivalent to OR. e.g. P12345

  • Implicit fields are used when no field is specified (simple search). For instance, if you put ‘P12345’ in the simple query box, this will mean the same as identifier:P12345 OR pubid:P12345 OR pubauth:P12345 OR species:P12345 OR type:P12345 OR detmethod:P12345 OR interaction_id:P12345

About the MITAB output

The output returned by a query contains a list of entries. Each entry is formatted following the MITAB output.

Here below are listed the name of the field returned ordered as they would appear in one entry. The first item is always idA whatever version of MITAB is used. The version 25 of MITAB contains the first 15 fields in the table below. Newer version may incude more fields but always include the 15 from MITAB 25 in the same order. See the link from irefindex about mitab for more information.

Field Name

Searches on

Implicit*

Example

idA

Identifier A

No

idA:P74565

idB

Identifier B

No

idB:P74565

id

Identifiers (A or B)

No

id:P74565

alias

Aliases (A or B)

No

alias:(KHDRBS1 HCK)

identifiers

Identifiers and Aliases undistinctively

Yes

identifier:P74565

pubauth

Publication 1st author(s)

Yes

pubauth:scott

pubid

Publication Identifier(s) OR

Yes

pubid:(10837477 12029088)

taxidA

Tax ID interactor A: the tax ID or the species name

No

taxidA:mouse

taxidB

Tax ID interactor B: the tax ID or species name

No

taxidB:9606

species

Species. Tax ID A or Tax ID B

Yes

species:human

type

Interaction type(s)

Yes

type:”physical interaction”

detmethod

Interaction Detection method(s)

Yes

detmethod:”two hybrid*”

interaction_id

Interaction identifier(s)

Yes

interaction_id:EBI-761050

pbioroleA

Biological role A

Yes

pbioroleA:ancillary

pbioroleB

Biological role B

Yes

pbioroleB:”MI:0684”

pbiorole

Biological roles (A or B)

Yes

pbiorole:enzyme

ptypeA

Interactor type A

Yes

ptypeA:protein

ptypeB

Interactor type B

Yes

ptypeB:”gene”

ptype

Interactor types (A or B)

Yes

pbiorole:”small molecule”

pxrefA

Interactor xref A (or Identifier A)

Yes

pxrefA:”GO:0003824

pxrefB

Interactor xref B (or Identifier B)

Yes pxrefB:”GO:0003824

pxref

Interactor xrefs (A or B or Identifier A or Identifier B)

Yes

pxref:”catalytic activity”

xref

Interaction xrefs (or Interaction identifiers)

Yes

xref:”nuclear pore”

annot

Interaction annotations and tags

Yes

annot:”internally curated”

udate

Update date

Yes

udate:[20100101 TO 20120101]

negative

Negative interaction boolean

Yes

negative:true

complex

Complex expansion

Yes

complex:”spoke expanded”

ftypeA

Feature type of participant A

Yes

ftypeA:”sufficient to bind”

ftypeB

Feature type of participant B

Yes

ftypeB:mutation

ftype

Feature type of participant A or B

Yes

ftype:”binding site”

pmethodA

Participant identification method A

Yes

pmethodA:”western blot”

pmethodB

Participant identification method B

Yes

pmethodB:”sequence tag identification”

pmethod

Participant identification methods

(A or B)

Yes

pmethod:immunostaining

stc

Stoichiometry (A or B). Only true or false, just to be able to filter interaction having stoichiometry available

Yes

stc:true

param

Interaction parameters. Only true or false, just to be able to filter interaction having parameters available

Yes

param:true

class PSICQUIC(verbose=True)[source]

Interface to the PSICQUIC service

There are 2 interfaces to the PSICQUIC service (REST and WSDL) but we used the REST only.

This service provides a common interface to more than 25 other services related to protein. So, we won’t detail all the possiblity of this service. Here is an example that consists of looking for interactors of the protein ZAP70 within the IntAct database:

>>> from bioservices import *
>>> s = PSICQUIC()
>>> res = s.query("intact", "zap70")
>>> len(res) # there are 11 interactions found
11
>>> for x in res[1]:
...     print(x)
uniprotkb:O95169
uniprotkb:P43403
intact:EBI-716238
intact:EBI-1211276
psi-mi:ndub8_human(display_long)|uniprotkb:NADH-ubiquinone oxidoreductase ASHI
.
.

Here we have a list of entries. There are 15 of them (depending on the output parameter). The meaning of the entries is described on PSICQUIC website: https://code.google.com/p/psicquic/wiki/MITAB25Format . In short:

  1. Unique identifier for interactor A

  2. Unique identifier for interactor B.

  3. Alternative identifier for interactor A, for example the official gene

  4. Alternative identifier for interactor B.

  5. Aliases for A, separated by “|

  6. Aliases for B.

  7. Interaction detection methods, taken from the corresponding PSI-MI

  8. First author surname(s) of the publication(s)

  9. Identifier of the publication

  10. NCBI Taxonomy identifier for interactor A.

  11. NCBI Taxonomy identifier for interactor B.

  12. Interaction types,

  13. Source databases and identifiers,

  14. Interaction identifier(s) i

  15. Confidence score. Denoted as scoreType:value.

Another example with reactome database:

res = s.query("reactome", "Q9Y266")

Warning

PSICQUIC gives access to 25 other services. We cannot create a dedicated parsing for all of them. So, the ::query method returns the raw data. Addition class may provide dedicated parsing in the future.

Constructor

Parameters

verbose (bool) – print informative messages

>>> from bioservices import PSICQUIC
>>> s = PSICQUIC()
property activeDBs

returns the active DBs only

convert(data, db=None)[source]
convertAll(data)[source]
property formats

Returns the possible output formats

getInteractionCounter(query)[source]

Returns a dictionary with database as key and results as values

Parameters

query (str) – a valid query

Returns

a dictionary which key as database and value as number of entries

Consider only the active database.

getName(data)[source]
knownName(data)[source]

Scan all entries (MITAB) and returns simplified version

Each item in the input list of mitab entry The output is made of 2 lists corresponding to interactor A and B found in the mitab entries.

elements in the input list takes the following forms:

DB1:ID1|DB2:ID2
DB3:ID3

The | sign separates equivalent IDs from different databases.

We want to keep only one. The first known databae is kept. If in the list of DB:ID pairs no known database is found, then we keep the first one whatsover.

known databases are those available in the uniprot mapping tools.

chembl and chebi IDs are kept unchanged.

mappingOneDB(data)[source]
postCleaning(data, keep_only='HUMAN', remove_db=['chebi', 'chembl'], keep_self_loop=False, verbose=True)[source]

Remove entries with a None and keep only those with the keep pattern

postCleaningAll(data, keep_only='HUMAN', flatten=True, verbose=True)[source]

even more cleaing by ignoring score, db and interaction len(set([(x[0],x[1]) for x in retnew]))

preCleaning(data)[source]

remove entries ehre IdA or IdB is set to “-”

print_status()[source]

Prints the services that are available

Returns

Nothing

The output is tabulated. The columns are:

  • names

  • active

  • count

  • version

  • rest URL

  • soap URL

  • rest example

  • restricted

See also

If you want the data into lists, see all attributes starting with registry such as registry_names()

query(service, query, output='tab25', version='current', firstResult=None, maxResults=None)[source]

Send a query to a specific database

Parameters
  • service (str) – a registered service. See registry_names.

  • query (str) – a valid query. Can be * or a protein name.

  • output (str) – a valid format. See s._formats

s.query("intact", "brca2", "tab27")
s.query("intact", "zap70", "xml25")
s.query("matrixdb", "*", "xml25")

This is the programmatic approach to this website:

http://www.ebi.ac.uk/Tools/webservices/psicquic/view/main.xhtml

Another example consist in accessing the string database for fetching protein-protein interaction data of a particular model organism. Here we restrict the query to 100 results:

s.query("string", "species:10090", firstResult=0, maxResults=100, output="tab25")

# spaces are automatically converted

s.query(“biogrid”, “ZAP70 AND species:9606”)

Warning

AND must be in big caps. Some database are ore permissive than other (e.g., intact accepts “and”). species must be a valid ID number. Again, some DB are more permissive and may accept the name (e.g., human)

To obtain the number of interactions in intact for the human specy:

>>> len(p.query("intact", "species:9606"))
queryAll(query, databases=None, output='tab25', version='current', firstResult=None, maxResults=None)[source]

Same as query but runs on all active database

Parameters

databases (list) – database to query. Queries all active DB if not provided

Returns

dictionary where keys correspond to databases and values to the output of the query.

res = s.queryAll("ZAP70 AND species:9606")
read_registry()[source]

Reads and returns the active registry

property registry

returns the registry of psicquic

property registry_actives

returns active state of each service

property registry_counts

returns number of entries in each service

property registry_names

returns all services available (names)

property registry_restexamples

retuns REST example for each service

property registry_restricted

returns restricted status of services

property registry_resturls

returns URL of REST services

property registry_soapurls

returns URL of WSDL service

property registry_versions

returns version of each service

Rhea

Interface to the Rhea web services

What is Rhea ?

URL

http://www.ebi.ac.uk/rhea/

Citations

See http://www.ebi.ac.uk/rhea/about.xhtml

Rhea is a reaction database, where all reaction participants (reactants and products) are linked to the ChEBI database (Chemical Entities of Biological Interest) which provides detailed information about structure, formula and charge. Rhea provides built-in validations that ensure both elemental and charge balance of the reactions… While the main focus of Rhea is enzyme-catalysed reactions, other biochemical reactions are also are included.

The database is extensively cross-referenced. Reactions are currently linked to the EC list, KEGG and MetaCyc, and the reactions will be used in the IntEnz database and in all relevant UniProtKB entries. Furthermore, the reactions will also be used in the UniPathway database to generate pathways and metabolic networks.

—from Rhea Home page, Dec 2012 (http://www.ebi.ac.uk/rhea/about.xhtml)

class Rhea(verbose=True, cache=False)[source]

Interface to the Rhea service

You can search by compound name, ChEBI ID, reaction ID, cross reference (e.g., EC number) or citation (author name, title, abstract text, publication ID). You can use double quotes - to match an exact phrase - and the following wildcards:

  • ? (question mark = one character),

  • * (asterisk = several characters).

Searching for caffe* will find reactions with participants such as caffeine, trans-caffeic acid or caffeoyl-CoA:

from bioservices import Rhea
r = Rhea()
response = r.search("caffe*")

Searching for a?e?o* will find reactions with participants such as acetoin, acetone or adenosine.:

from bioservices import Rhea
r = Rhea()
response = r.search("a?e?o*")

The search() entry() methods require a list of valid columns. By default all columns are used but you can restrict to only a few. Here is the description of the columns:

rhea-id :   reaction identifier (with prefix RHEA)
equation :  textual description of the reaction equation
chebi :     comma-separated list of ChEBI names used as reaction participants
chebi-id :  comma-separated list of ChEBI identifiers used as reaction participants
ec :        comma-separated list of EC numbers (with prefix EC)
uniprot :   number of proteins (UniProtKB entries) annotated with the Rhea reaction
pubmed :    comma-separated list of PubMed identifiers (without prefix)

and 5 cross-references:

reaction-xref(EcoCyc)
reaction-xref(MetaCyc)
reaction-xref(KEGG)
reaction-xref(Reactome)
reaction-xref(M-CSA)

Rhea constructor

Parameters

verbose (bool) – True by default

>>> from bioservices import Rhea
>>> r = Rhea()
get_metabolites(rxn_id)[source]

Given a Rhea (http://www.rhea-db.org/) reaction id, returns its participant metabolites as a dict: {metabolite: stoichiometry},

e.g. ‘2 H + 1 O2 = 1 H2O’ would be represented ad {‘H’: -2, ‘O2’: -1, ‘H2O’: 1}.

Parameters

rxn_id – Rhea reaction id

Returns

dict of participant metabolites.

query(query, columns=None, frmt='tsv', limit=None)[source]

Retrieve a concrete reaction for the given id in a given format

Parameters
  • query (str) – the entry to retrieve

  • frmt (str) – the result format (tsv); only tsv accepted for now (Nov 2020).

  • limit (int) – maximum number of results to retrieve

Returns

dataframe

Retrieve Rhea reaction identifiers and equation text:

r.query("", columns="rhea-id,equation", limit=10)

Retrieve Rhea reactions with enzymes curated in UniProtKB (only first 10 entries):

r.query("uniprot:*", columns="rhea-id,equation", limit=10)

To retrieve a specific entry:

df = r.get_entry("rhea:10661")

Changed in version 1.8.0: (entry() method renamed in query() and no more format required. Must be given in the entry name e.g. query(“10281.rxn”) instead of entry(10281, format=”rxn”) the option frmt is now related to the result format

search(query, columns=None, limit=None, frmt='tsv')[source]

Search for Rhea (mimics https://www.rhea-db.org/)

Parameters
  • query (str) – the search term using format parameter

  • format (str) – the biopax2 or cmlreact format (default)

Returns

A pandas DataFrame.

>>> r = Rhea()
>>> df = r.search("caffeine")
>>> df = r.search("caffeine", columns='rhea-id,equation')
Reactome

Interface to the Reactome webs services

What is Reactome?

URL

http://www.reactome.org/ReactomeGWT/entrypoint.html

Citation

http://www.reactome.org/citation.html

REST

http://reactomews.oicr.on.ca:8080/ReactomeRESTfulAPI/RESTfulWS

“REACTOME is an open-source, open access, manually curated and peer-reviewed pathway database. Pathway annotations are authored by expert biologists, in collaboration with Reactome editorial staff and cross-referenced to many bioinformatics databases. These include NCBI Entrez Gene, Ensembl and UniProt databases, the UCSC and HapMap Genome Browsers, the KEGG Compound and ChEBI small molecule databases, PubMed, and Gene Ontology. … “

—from Reactome web site

class Reactome(verbose=True, cache=False)[source]

Todo

interactors, orthology, particiapnts, person, query, refernces, schema

get_complex_subunits(identifier, excludeStructuresSpecifies=False)[source]

A list with the entities contained in a given complex

Retrieves the list of subunits that constitute any given complex. In case the complex comprises other complexes, this method recursively traverses the content returning each contained PhysicalEntity. Contained complexes and entity sets can be excluded setting the ‘excludeStructures’ optional parameter to ‘true’

Parameters
  • identifier – The complex for which subunits are requested

  • excludeStructures – Specifies whether contained complexes and entity sets are excluded in the response

r.get_complex_subunits("R-HSA-5674003")
get_complexes(resources, identifier)[source]

A list of complexes containing the pair (identifier, resource)

Retrieves the list of complexes that contain a given (identifier, resource). The method deconstructs the complexes into all its participants to do so.

Parameters
  • resource – The resource of the identifier for complexes are requested (e.g. UniProt)

  • identifier – The identifier for which complexes are requested

r.get_complexes(resources, identifier)
r.get_complexes("UniProt", "P43403")
get_discover(identifier)[source]

The schema.org for an Event in Reactome knowledgebase

For each event (reaction or pathway) this method generates a json file representing the dataset object as defined by schema.org (http). This is mainly used by search engines in order to index the data

r.data_discover("R-HSA-446203")
get_diseases()[source]

list of diseases objects

get_diseases_doid()[source]

retrieves the list of disease DOIDs annotated in Reactome

return: dictionary with DOID contained in the values()

get_entity_componentOf(identifier)[source]

A list of larger structures containing the entity

Retrieves the list of structures (Complexes and Sets) that include the given entity as their component. It should be mentioned that the list includes only simplified entries (type, names, ids) and not full information about each item.

r.get_entity_componentOf("R-HSA-199420")
get_entity_otherForms(identifier)[source]

All other forms of PhysicalEntity

Retrieves a list containing all other forms of the given PhysicalEntity. These other forms are PhysicalEntities that share the same ReferenceEntity identifier, e.g. PTEN H93R[R-HSA-2318524] and PTEN C124R[R-HSA-2317439] are two forms of PTEN.

r.get_entity_otherForms("R-HSA-199420")
get_event_ancestors(identifier)[source]

The ancestors of a given event

The Reactome definition of events includes pathways and reactions. Although events are organised in a hierarchical structure, a single event can be in more than one location, i.e. a reaction can take part in different pathways while, in the same way, a sub-pathway can take part in many pathways. Therefore, this method retrieves a list of all possible paths from the requested event to the top level pathway(s).

Parameters

identifier – The event for which the ancestors are requested

r.get_event_ancestors("R-HSA-5673001")
get_eventsHierarchy(species)[source]

The full event hierarchy for a given species

Events (pathways and reactions) in Reactome are organised in a hierarchical structure for every species. By following all ‘hasEvent’ relationships, this method retrieves the full event hierarchy for any given species. The result is a list of tree structures, one for each TopLevelPathway. Every event in these trees is represented by a PathwayBrowserNode. The latter contains the stable identifier, the name, the species, the url, the type, and the diagram of the particular event.

Parameters

species – Allowed species filter: SpeciesName (eg: Homo sapiens) SpeciesTaxId (eg: 9606)

r.get_eventsHierarchy(9606)
get_exporter_diagram(identifier, ext='png', quality=5, diagramProfile='Modern', analysisProfile='Standard', filename=None)[source]

Export a given pathway diagram to raster file

This method accepts identifiers for Event class instances. When a diagrammed pathway is provided, the diagram is exported to the specified format. When a subpathway is provided, the diagram for the parent is exported and the events that are part of the subpathways are selected. When a reaction is provided, the diagram containing the reaction is exported and the reaction is selected.

Parameters
  • identifier – Event identifier (it can be a pathway with diagram, a subpathway or a reaction)

  • ext – File extension (defines the image format) in png, jpeg, jpg, svg, gif

  • quality – Result image quality between [1 - 10]. It defines the quality of the final image (Default 5)

  • flg – not implemented

  • sel – not implemented

  • diagramProfile – Diagram Color Profile

  • token – not implemented

  • analysisProfile – Analysis Color Profile

  • expColumn – not implemented

  • filename – if given, save the results in the provided filename

return: raw data if filename parameter is not set. Otherwise, the data

is saved in the filename and the function returns None

get_exporter_fireworks()[source]
get_exporter_reaction()[source]
get_exporter_sbml(identifier)[source]

Export given Pathway to SBML

Parameters

identifier – DbId or StId of the requested database object

r.exporter_sbml("R-HSA-68616")
get_interactors_psicquic_molecule_details()[source]

Retrieve clustered interaction, sorted by score, of a given accession by resource.

get_interactors_psicquic_molecule_summary()[source]

Retrieve a summary of a given accession by resource

get_interactors_psicquic_resources()[source]

Retrieve a list of all Psicquic Registries services

get_interactors_static_molecule_details()[source]

Retrieve a detailed interaction information of a given accession

get_interactors_static_molecule_pathways()[source]

Retrieve a list of lower level pathways where the interacting molecules can be found

get_interactors_static_molecule_summary()[source]

Retrieve a summary of a given accession

get_mapping_identifier_pathways(resource, identifier)[source]
get_mapping_identifier_reactions(resource, identifier)[source]
get_pathway_containedEvents(identifier)[source]

All the events contained in the given event

Events are the building blocks used in Reactome to represent all biological processes, and they include pathways and reactions. Typically, an event can contain other events. For example, a pathway can contain smaller pathways and reactions. This method recursively retrieves all the events contained in any given event.

res = r.get_pathway_containedEvents("R-HSA-5673001")
get_pathway_containedEvents_by_attribute(identifier, attribute)[source]

A single property for each event contained in the given event

Events are the building blocks used in Reactome to represent all biological processes, and they include pathways and reactions. Typically, an event can contain other events. For example, a pathway can contain smaller pathways (subpathways) and reactions. This method recursively retrieves a single attribute for each of the events contained in the given event.

Parameters
  • identifier – The event for which the contained events are requested

  • attribute – Attrubute to be filtered

r.get_pathway_containedEvents_by_attribute("R-HSA-5673001", "stId")
get_pathways_low_diagram_entity(identifier)[source]

A list of lower level pathways with diagram containing a given entity or event

This method traverses the event hierarchy and retrieves the list of all lower level pathways that have a diagram and contain the given PhysicalEntity or Event.

Parameters
  • identifier – The entity that has to be present in the pathways

  • species – The species for which the pathways are requested. Taxonomy identifier (eg: 9606) or species name (eg: ‘Homo sapiens’)

r.get_pathways_low_diagram_entity("R-HSA-199420")
get_pathways_low_diagram_entity_allForms(identifier)[source]
r.get_pathways_low_diagram_entity_allForms("R-HSA-199420")
get_pathways_low_entity(identifier)[source]

A list of lower level pathways containing a given entity or event

This method traverses the event hierarchy and retrieves the list of all lower level pathways that contain the given PhysicalEntity or Event.

r.get_pathways_low_entity("R-HSA-199420")
get_pathways_low_entity_allForms(identifier)[source]

A list of lower level pathways containing any form of a given entity

This method traverses the event hierarchy and retrieves the list of all lower level pathways that contain the given PhysicalEntity in any of its variant forms. These variant forms include for example different post-translationally modified versions of a single protein, or the same chemical in different compartments.

r.get_pathways_low_entity_allForms("R-HSA-199420")
get_pathways_top(species)[source]
get_references(identifier)[source]

All referenceEntities for a given identifier

Retrieves a list containing all the reference entities for a given identifier.

r.get_references(15377)
get_species_all()[source]

the list of all species in Reactome

get_species_main()[source]

the list of main species in Reactome

r.get_species_main()
property name
search_facet()[source]

A list of facets corresponding to the whole Reactome search data

This method retrieves faceting information on the whole Reactome search data.

search_facet_query(query)[source]

A list of facets corresponding to a specific query

This method retrieves faceting information on a specific query

search_query(query)[source]

Queries Solr against the Reactome knowledgebase

This method performs a Solr query on the Reactome knowledgebase. Results can be provided in a paginated format.

search_spellcheck(query)[source]

Spell-check suggestions for a given query

This method retrieves a list of spell-check suggestions for a given search term.

search_suggest(query)[source]

Autosuggestions for a given query

This method retrieves a list of suggestions for a given search term.

>>> r.http_get("search/suggest?query=apopt")
['apoptosis', 'apoptosome', 'apoptosome-mediated', 'apoptotic']
property version
Readseq

This module provides a class Seqret to access to Seqret WS.

What is Seqret ?

URL

http://www.ebi.ac.uk/Tools/services/rest/seqret/

Service

Citations

http://www.ncbi.nlm.nih.gov/pubmed/18428689

EMBOSS seqret reads and converts biosequences between a selection of common biological sequence formats, including EMBL, GenBank and fasta sequence formats.

Seqret homepage – Sep 2017

class Seqret(verbose=True)[source]

Interface to the Seqret service

>>> from bioservices import *
>>> s = Seqret()

The ReadSeq service was replaced by #the Seqret services (2015).

Changed in version 0.15.

Constructor

Parameters

verbose (bool) –

get_parameter_details(parameterId)[source]

Get details of a specific parameter.

Parameters

parameter (str) – identifier/name of the parameter to fetch details of.

Returns

a data structure describing the parameter and its values.

rs = ReadSeq()
print(rs.get_parameter_details("stype"))
get_parameters()[source]

Get a list of the parameter names.

Returns

a list of strings giving the names of the parameters.

get_result(jobid, result_type='out')[source]

Get the result of a job of the specified type.

Parameters
  • jobid (str) – job identifier.

  • parameters – optional list of wsRawOutputParameter used to provide additional parameters for derived result types.

get_result_types(jobid)[source]

Get the available result types for a finished job.

Parameters

jobid (str) – job identifier.

Returns

a list of wsResultType data structures describing the available result types.

get_status(jobid=None)[source]

Get the status of a submitted job.

Parameters

jobid (str) – job identifier.

Returns

string containing the status.

The values for the status are:

  • RUNNING: the job is currently being processed.

  • FINISHED: job has finished, and the results can then be retrieved.

  • ERROR: an error occurred attempting to get the job status.

  • FAILURE: the job failed.

  • NOT_FOUND: the job cannot be found.

property parameters

Get list of parameter names

run(email, title, **kargs)[source]

Submit a job to the service.

Parameters
Returns

string containing the job identifier (jobId).

Deprecated (olf readseq service):

Format Name     Value
Auto-detected   0
EMBL            4
GenBank         2
Fasta(Pearson)  8
Clustal/ALN     22
ACEDB           25
BLAST           20
DNAStrider      6
FlatFeat/FFF    23
GCG             5
GFF             24
IG/Stanford     1
MSF             15
NBRF            3
PAUP/NEXUS      17
Phylip(Phylip4)     12
Phylip3.2       11
PIR/CODATA      14
Plain/Raw       13
SCF             21
XML             19

As output, you also have

Pretty 18

s = readseq.Seqret()
jobid = s.run("cokelaer@test.co.uk", "test", sequence=fasta, inputformat=8,
    outputformat=2)
genbank = s.get_result(s._jobid)
UniChem

This module provides a class UniChem

What is UniChem

URL

https://www.ebi.ac.uk/unichem/info/webservices

REST

https://www.ebi.ac.uk/unichem/rest

“UniChem is a ‘Unified Chemical Identifier’ system, designed to assist in the rapid cross-referencing of chemical structures, and their identifiers, between databases (read more). “

—From UniChem web page June 2013

class UniChem(verbose=False, cache=False)[source]

Interface to the UniChem service

>>> from bioservices import UniChem
>>> u = UniChem()

There are lots of sources such as Chembl, Chebi, etc. You will probably need the identifiers of those sources. You can get all information about a source using these methods:

# Get information about a source
u.get_source_info_by_name('chembl')
u.get_source_info_by_id(10)
u.get_id_from_name('chembl')
u.get_all_src_ids()

but for developers, everything is contained in the source_ids dictionary.

The first important method provided by Unichem API is the get_compounds(). For example, you can request all compounds related to the CHEMBL12 identifier from ChEMBL using:

res = u.get_compounds('CHEMBL12', 'chembl')
compounds = res['compounds'][0]

Note that the second argument is ‘chembl’ and lower/upper cases is important. All names are stored in source_ids together with their identifiers.

You can use also get_id_from_name() and get_name_from_id` if needed.

Legacy methods are available:

get_compound_ids_from_src_id –> use get_compounds() get_src_compound_ids_from_inchikey –> replaced by get_compounds() get_all_src_ids() –> uses new API get_src_compound_ids_all_from_inchikey –> get_source_by_inchikey() get_verbose_src_compound_ids_from_inchikey –> get_sources_by_inchikey_verbose() get_structure –> uses new API get_compounds() and bioservices code get_structure_all –> dropped get_src_compound_id_url –> dropped. One can use the get_compounds() get_src_compound_ids_all_from_obsolete –> removed

get_src_compound_ids_from_src_compound_id –> removed; was obsolet get_src_compound_ids_all_from_src_compound_id –> remoed was already obsolet get_all_compound_ids_from_all_src_id –> removed. no more API get_mapping –> removed. no more API get_auxiliary_mappings –> removed. no more API

Most old functions can be replaced by a syntax such as:

res = u.get_compound('CHEMBL12', 'chembl')
res['compounds'][0]

Constructor UniChem

Parameters

verbose – set to False to prevent informative messages

get_all_src_ids()[source]

Obtain all src_ids of sources available in UniChem

Returns

list of ‘src_id’s.

uni.get_all_src_ids()
get_compounds(compound, source_type)[source]

Get matched compounds information

Parameters
  • compound (str) – InChI, InChIKey, Name, UCI or Compound Source ID

  • source_type – uci, inchi, inchikey, sourceID (e.g. chembl)

  • sourceID (str) – ID for the source assigned in UniChem when the type is “sourceID”

Returns

a list of matched compounds and their assigned sources

A legacy function allows you to retrieve a compound from its inchikey:

u.get_sources_by_inchikey('GZUITABIAKMVPG-UHFFFAOYSA-N')

However, this new function is faster presumably and allows you to do the same:

res = u.get_compounds('GZUITABIAKMVPG-UHFFFAOYSA-N', 'inchikey')
res['compounds']

You can get the first element, from which inchi, sources, standardInchikey, uci can be extracted. The sources key contains all compound identifiers for each source:

res['compounds'][0]['uci']
res['compounds'][0]['sources']

Looks like there is always a single element in res[‘compounds’] but since it is a list, you must access to first element (unique) using [0] syntax.

get_connectivity(compound, source_type)[source]

Fetch multiple source data sets for a given compound with common connectivity to a given id on the database source, InChI, InChIkey or UCI

Parameters
  • compound (str) – InChI, InChIKey, Name, UCI or Compound Source ID (e.g. chembl)

  • source_type – uci, inchi, inchikey, sourceID

The returned dictionary contains 5 keys:

  • response: service response (‘Success’ if everything is right)

  • searchedCompound: the summary in terms of inchi, standardInchikey and uci

  • sources: a dictionary with e.g. compoundID and name of the source.

    A ‘comparison’ dictionary is also provided.

  • totalCompounds: number of searchedCompound entries

  • totalSources: number of sources entries

get_id_from_name(name)[source]

Return the ID a a source given its name.

Parameters

name (str) – a valid database name (e.g., chembl)

u.get_id_from_name("chembl")
get_images(uci, filename=None)[source]

Return / create compound image

Parameters
  • uci – the UCI of the compound

  • filename – optional file name to save the SVG+XML output

Returns

the SVG+XML string

(Source code)

get_inchi_from_inchikey(inchikey)[source]

Get a list of inchis given a valid inchikey.

Parameters

inchikey – InChI Key to search. Unlike the rest API, you can also provide a list.

Returns

a list of inchis matching the InChI Key provided. If input is a list, a dictionary is returned where keys are the inchikey input lists.

from bioservices import UniChem
u = UniChem()
res = u.get_inchi("AAOVKJBEBIDNHE-UHFFFAOYSA-N")

Note

this is a legacy function. introduced in v1.9 after unichem API update

get_source_info_by_id(ID)[source]
get_source_info_by_name(src_name)[source]

Description: Obtain all information on a source by querying with a source id

Parameters

src_name (int) – valid identifiers can be found in source_ids e.g. chebi, chembl)

Returns

dictionary (or list of dictionaries) with following keys:

  • UCICount: number of entries

  • baseIdUrl: URL of the source

  • created: date of creation

  • description: a description of the content of the source

  • lastUpdated: last date of the update

  • name: the unique name for the source in UniChem, always lower case

  • nameLabel: A name for the source suitable for use as a ‘label’ for the source

  • nameLong: the full name of the source, as defined by the source

  • private: is it private or not ?

  • sourceID: the src_id for this source

  • srcDetails: details about the source

  • srcReleaseDate: release date of the source database

  • srcReleaseNumber: release number of the source

  • srcUrl: src_url (the main home page of the source)

  • updateComments: possible updates from this source

>>> res = get_source_by_name("chebi")
get_sources()[source]

Returns all information about all sources used in Unichem

from bioservices import UniChem
u = UniChem()
res = u.get_sources_information()
res['sources']
get_sources_by_inchikey(inchikey)[source]

Get sources by inchikey

Parameters

inchikey – InChI Key to search. Unlike the rest API, you can also provide a list.

Returns

A list of sources for the provided InChIKey if input is a single string. a dictionary with keys as inchikey if input is a list.

Note

this is a legacy function. introduced in v1.9 after unichem API update

get_sources_by_inchikey_verbose(inchikey)[source]

Get sources by inchikey

Parameters

inchikey – InChI Key to search. Unlike the rest API, you can also provide a list.

Returns

A list of sources for the provided InChIKey if input is a single string. a dictionary with keys as inchikey if input is a list.

Note

this is a legacy function. introduced in v1.9 after unichem API update

get_structure(compound_id, src_id)[source]

Obtain structure(s) CURRENTLY assigned to a query src_compound_id.

Parameters
  • compound_id (str) – a valid compound identifier

  • src_id (int) – corresponding database identifier (name or id).

Returns

dictionary with ‘standardinchi’ and ‘standardinchikey’ keys

>>> uni.get_structure("CHEMBL12", "chembl")
UniProt

Interface to some part of the UniProt web service

What is UniProt ?

URL

http://www.uniprot.org

Citation

“The Universal Protein Resource (UniProt) is a comprehensive resource for protein sequence and annotation data. The UniProt databases are the UniProt Knowledgebase (UniProtKB), the UniProt Reference Clusters (UniRef), and the UniProt Archive (UniParc). The UniProt Metagenomic and Environmental Sequences (UniMES) database is a repository specifically developed for metagenomic and environmental data.”

—From Uniprot web site (help/about) , Dec 2012

class UniProt(verbose=False, cache=False)[source]

Interface to the UniProt service

>>> from bioservices import UniProt
>>> u = UniProt(verbose=False)
>>> u.mapping("UniProtKB_AC-ID", "KEGG", query='P43403')
defaultdict(<type 'list'>, {'P43403': ['hsa:7535']})
>>> res = u.search("P43403")

# Returns sequence on the ZAP70_HUMAN accession Id
>>> sequence = u.search("ZAP70_HUMAN", columns="sequence")

Changed in version 1.10: Uniprot update its service in June 2022. Changes were made in the bioservices API with small changes. User API is more or less the same. Main issues that may be faced are related to change of output column names. Please see the _legacy_names for corresponding changes.

Some notes about searches. The and and or are now upper cases. The organism and taxonomy fields are now organism_id and taxonomy_id

Constructor

Parameters
  • verbose – set to False to prevent informative messages

  • cache – set to True to cache request

get_df(entries, nChunk=100, organism=None, limit=10, columns=None, progress=False)[source]

Given a list of uniprot entries, this method returns a dataframe with all possible columns

Parameters
  • entries – list of valid entry name. if list is too large (about >200), you need to split the list

  • chunk

  • limit – limit number of entries per identifier to 10. You can set it to None to keep all entries but this will be very slow

Returns

dataframe with indices being the uniprot id (e.g. DIG1_YEAST)

To get about 100 columns related to the accession P62988, type:

df = u.get_df(‘P62988’)

Note that you may preceed the accesion by the keyword **sec_acc) to access secondary accessions numbers:

df = u.get_df('sec_acc:P62988')
get_fasta(uniprot_id)[source]

Returns FASTA string given a valid identifier

Parameters

uniprot_id (str) – a valid identifier (e.g. P12345)

This is just an alias to retrieve() when setting the format to ‘fasta’. Method kept for legacy.

mapping(fr='UniProtKB_AC-ID', to='KEGG', query='P13368', polling_interval_seconds=3, max_waiting_time=100, progress=True)[source]

This is an interface to the UniProt mapping service

Parameters
  • fr – the source database identifier. See valid_mapping.

  • to – the targetted database identifier. See valid_mapping.

  • query – a string containing one or more IDs separated by a comma It can also be a list of strings.

  • polling_interval_seconds – the number of seconds between each status check of the current job

  • max_waiting_time – the maximum number of seconds to wait for the final answer.

Returns

a dictionary with two possible keys. The first one is ‘results’ with the from / to answers and the second one ‘failedIds’ with Ids that were not found

>>> u.mapping("UniProtKB_AC-ID", "KEGG", 'P43403')
{'results': [{'from': 'P43403', 'to': 'hsa:7535'}]}

The output is a dictionary. Identifiers that were not found are stored in the keys ‘failedIds’. Succesful queries are stored in the ‘results’ key that is a list of dictionaries with two keys set to ‘from’ and ‘to’. The ‘from’ key should be in your input list. The ‘to’ key is the result. Here we have the KEGG identifier recognised by its prefix ‘hsa:’, which is for human. Sometimes the output (‘to’) it is more complicated. Consider the following example:

u.mapping("UniParc", "UniProtKB", 'UPI0000000001,UPI0000000002')

You will see that the UniParc results is more complex than just an identifier.

See valid_mapping attribute for list of valid mapping identifiers.

Note that according to Uniprot (June 2022), there are various limits on ID Mapping Job Submission:

Limit

Details

100,000

Total number of ids allowed in comma separated param ids in /idmapping/run api

500,000

Total number of “mapped to” ids allowed

100,000

Total number of “mapped to” ids allowed to be enriched by UniProt data

10,000

Total number of “mapped to” ids allowed with filtering

Changed in version 1.1.1: to return a dictionary instaed of a list

Changed in version 1.1.2: the values for each key is now made of a list instead of strings so as to store more than one values.

Changed in version 1.2.0: input query can also be a list of strings instead of just a string

Changed in version 1.3.1: use http_post instead of http_get. This is 3 times faster and allows queries with more than 600 entries in one go.

Changed in version 1.10.0: new API due to uniprot website update

Changed in version 1.11.0: implement batch to prevent limit of 25 results.

a specialised version of search()

This is equivalent to:

u = uniprot.UniProt()
u.search(query, frmt='tsv', sort="score", limit=1)
Returns

a dictionary.

retrieve(uniprot_id, frmt='json', database='uniprot', include=False)[source]

Search for a uniprot ID in UniProtKB database

Parameters
  • uniprot (str) – a valid UniProtKB ID, or uniref, uniparc or taxonomy.

  • frmt (str) – expected output format amongst xml, txt, fasta, gff, rdf

  • database (str) – database name in (uniprot, uniparc, uniref, taxonomy)

  • include (bool) – include data with RDF format.

Returns

if the parameter uniprot_id is string, the output will be a a list of identifiers is provided, the output is also a list otherwise, a string. The content of the string of items in the list depends on the value of frmt.

>>> u = UniProt()
>>> res = u.retrieve("P09958", frmt="txt")
>>> fasta = u.retrieve(['P29317', 'Q5BKX8', 'Q8TCD6'], frmt='fasta')
>>> print(fasta[0])

Changed in version 1.10: the xml format is now returned as raw XML. It is not interpreted anymore. The RDF has now an additional option to include data from referenced data sets directly in the returned data (set include=True parameter). Default output format is now set to json.

search(query, frmt='tsv', columns=None, include_isoforms=False, sort='score', compress=False, limit=None, size=25, database='uniprotkb', progress=True)[source]

Provide some interface to the uniprot search interface.

Parameters
  • query (str) – query must be a valid uniprot query. See https://www.uniprot.org/help/query-fields and examples below

  • frmt (str) – a valid format amongst xlsx, fasta, gff, tsv and json. OTher format are not available within bioservices (rss, obo, rdf, xml) (default is tsv)

  • columns (str) – comma-separated list of values. Works only if fomat is tsv or xlsx. For UnitProtKB, some possible columns are: id, entry name, length, organism. See also valid_mapping for the full list of column keywords.

  • include_isoform (bool) – include isoform sequences when the frmt parameter is fasta. Include description when frmt is rdf.

  • sort (str) – by score by default. Set to None to bypass this behaviour

  • compress (bool) – gzip the results

  • limit (int) – Stops the download of results once this limit is crossed. if size is 25 and limit is set to 30, 25+25 results will be returned though. users need to do a post filtering.

  • size (int) – chunk of results (25 by default on uniprot website).

Returns

depends on the value of frmt. Uniprot API returns all results in several pages with size elements per page. If frmt is set to xlsx, output is a list of excel-like page with size per item. If frmt is set to tsv, bioservices concatenate all pages in a single string. Similarly for gff, fasta or json, bioservices concatenates all pages in a single variable (txt or dictionary depending on the requested format).

To obtain the list of uniprot ID returned by the search of zap70 can be retrieved as follows:

>>> u.search('zap70+AND+organism_id:9606')
>>> u.search("zap70+AND+taxonomy_id:9606", frmt="tsv", limit=3,
...    columns="entry_name,length,id, gene_names")
Entry name  Length  Entry   Gene names
CBLB_HUMAN  982 Q13191  CBLB RNF56 Nbla00127
CBL_HUMAN   906 P22681  CBL CBL2 RNF55
CD3Z_HUMAN  164 P20963  CD247 CD3Z T3Z TCRZ

other examples:

>>> u.search("ZAP70+AND+organism_id:9606", limit=3, columns="id,xref_pdb")

You can also do a search on several keywords. This is especially useful if you have a list of known entry names.:

>>> u.search("ZAP70_HUMAN+OR+CBL_HUMAN", frmt="tsv", limit=3,
...    columns="entry name,length,id, genes")
Entry name  Length  Entry   Gene names

Finally, note that when you search for a query, you may have several hits:

>>> u.search("P12345)

including the ID P12345 but also related entries. If you need only the entry that perfectly match the query, use:

>>> u.search("accession:P12345")

This was provided from a user issue that was solved here: https://github.com/cokelaer/bioservices/issues/122

Warning

some columns although valid may not return anything, not even in the header: ‘score’, ‘taxonomy’, ‘tools’. this is a uniprot feature, not bioservices.

Changed in version 1.10: Due to uniprot API changes in June 2022:

  • parameter ‘include’ is now named ‘include_isoform

  • default parameter ‘tab’ is now ‘tsv’ but does not change the results

Changed in version 1.11:

  • removed the offset argument

  • add size parameter and keep limit parameter

  • add progress bar option (True by default)

  • drop frmt in : rdf, obo, xml, html

uniref(query)[source]

Calls UniRef service

This is an alias to retrieve()

>>> u = UniProt()
>>> u.uniref("Q03063")

Another example from https://github.com/cokelaer/bioservices/issues/121 is the combination of uniprot and uniref filters:

u.uniref("uniprot:(ec:1.1.1.282 taxonomy_name:bacteria reviewed:true)")

Changed in version 1.10: due to uniprot API changes in June 2022, we now return a json instead of a pandas dataframe.

property valid_mapping
DBFetch

Interface to DBFetch web service

What is DBFetch

URL

http://www.ebi.ac.uk/Tools/webservices/services/dbfetch

Service

http://www.ebi.ac.uk/Tools/webservices/services/dbfetch_rest

“DBFetch allows you to retrieve entries from various up-to-date biological databases using entry identifiers or accession numbers. This is equivalent to the CGI based dbfetch service. Like the CGI service a request can return a maximum of 200 entries.”

—From http://www.ebi.ac.uk/Tools/webservices/services/dbfetch , Dec 2012

class DBFetch(verbose=False)[source]

Interface to DBFetch service

>>> from bioservices import DBFetch
>>> w = DBFetch()
>>> data = w.fetchBatch("uniprot" ,"zap70_human", "xml", "raw")

For more information about the API, check this page: http://www.ebi.ac.uk/Tools/dbfetch/syntax.jsp

Constructor

Parameters

verbose (bool) – print informative messages

fetch(query, db='ena_sequence', format='default', style='raw', pageHtml=False)[source]

Fetch an entry in a defined format and style.

Parameters
  • query (str) – the entry identifier in db:id format (e.g. ‘UniProtKB:WAP_RAT’).

  • format (str) – the name of the format required (default to fasta).

  • style (str) – the name of the style required (raw, default, html)

Returns

The format of the response depends on the format/style parameter.

from bioservices import DBFetch
u = DBFfetch()
db.fetch(db="ena_sequence", format="fasta", query="L12344,L12345")
db.fetch(db="uniprot", format="fasta", query="P53503")

If db is ommited, the default is ena_sequence. If formatare ommited, the default is EMBL format The default style is raw data.

get_all_database_info()[source]

Get details of all available databases, includes formats and result styles.

Returns

A list of data structures describing the databases. See getDatabaseInfo() for a description of the data structure.

get_database_format_styles(db, format)[source]

Get a list of style names available for a given database and format.

Parameters
  • db (str) – database name to get available styles for (e.g. uniprotkb).

  • format (str) – the data format to get available styles for (e.g. fasta).

Returns

An array of strings containing the style names.

>>> u.get_database_format_styles("uniprotkb", "fasta")
['default', 'raw', 'html']
get_database_formats(db)[source]

Get list of format names for a given database.

Parameters

db (str) – valid database name

>>> db.get_database_formats("uniprotkb")
['default',
 'annot',
 'entrysize',
 'fasta',
 'gff3',
 'seqxml',
 'uniprot',
 'uniprotrdfxml',
 'uniprotxml',
 'dasgff',
 'gff2']
get_database_info(db=None)[source]

Get details describing specific database (data formats, styles)

Parameters

db (str) – a valid database.

Returns

The output can be introspected and contains several attributes

>>> res = u.get_database_info('uniprotkb')
>>> print(res['description'])
'The UniProt Knowledgebase (UniProtKB) is the central access point for extensive curated protein information, including function, classification, and cross-references. Search UniProtKB to retrieve everything that is known about a particular sequence.'
property supported_databases

Alias to getSupportedDBs.

Wikipathway

Interface to the WikiPathway service

What is WikiPathway ?

URL

http://www.wikipathways.org/index.php/WikiPathways

REST

http://webservice.wikipathways.org/

Citation

doi:10.1371/journal.pone.0006447

” WikiPathways is an open, public platform dedicated to the curation of biological pathways by and for the scientific community.”

—From WikiPathway web site. Dec 2012

class WikiPathways(verbose=True, cache=False)[source]

Interface to Pathway service

>>> from bioservices import WikiPathways
>>> s = Wikipathway()
>>> s.organism  # default organism
'Homo sapiens'

Examples:

s.findPathwaysByText('MTOR')
s.getPathway('WP1471')
s.getPathwaysByOntologyTerm('DOID:344')
s.findPathwaysByXref('P45985')

The methods that require a login are not implemented (login(), updatePathway(), removeCurationTag(), saveCurationTag(), createPathway())

Methods not implemented at all:

  • u’getCurationTagHistory’: No API found in Wikipathway web page

  • u’getRelations’: No API found in Wikipathway web page

Constructor

Parameters

verbose (bool) –

createPathway(gpmlCode, authInfo)[source]

Create a new pathway on the WikiPathways website with a given GPML code.

Warning

Interface not exposed in bioservices.

Note

To create/modify pathways via the web service, you need to have an account with web service write permissions. Please contact us to request write access for the web service.

Parameters
  • gpml (str) – The GPML code.

  • auth (object WSAuth) – The authentication info.

Returns

WSPathwayInfo The pathway info for the created pathway (containing identifier, revision, etc.).

findInteractions(query)[source]

Find interactions defined in WikiPathways pathways.

Parameters

query (str) – The name of an entity to find interactions for (e.g. ‘P53’)

Returns

list of dictionaries

res = w.findInteractions("P53")
findPathwaysByLiterature(query)[source]

Find pathways by their literature references.

Parameters

query (str) – The query, can be a pubmed id, author name or title keyword.

Returns

dictionary with Pathway as keys

res = s.findPathwaysByLiterature(18651794)
findPathwaysByText(query, species=None)[source]

Find pathways using a textual search on the description and text labels of the pathway objects.

The query syntax offers several options:

  • Combine terms with AND and OR. Combining terms with a space is equal to using OR (‘p53 OR apoptosis’ gives the same result as ‘p53 apoptosis’).

  • Group terms with parentheses, e.g. ‘(apoptosis OR mapk) AND p53’

  • You can use wildcards * and ?. * searches for one or more characters, ? searches for only one character.

  • Use quotes to escape special characters. E.g. ‘“apoptosis*”’ will include the * in the search and not use it as wildcard.

This function supports REST-style invocation. Example: http://www.wikipathways.org/wpi/webservice/webservice.php/findPathwaysByText?query=apoptosis

Parameters
  • query (str) – The search query (e.g. ‘apoptosis’ or ‘p53’).

  • species (str) – The species to limit the search to (leave blank to search on all species).

Returns

Array of WSSearchResult An array of search results.

s.findPathwaysByText(query="p53 OR mapk",species='Homo sapiens')

Warning

AND or OR must be in big caps

findPathwaysByXref(ids, codes=None)[source]

Find pathways by searching on the external references of DataNodes.

Parameters
  • ids (str string) – One or mode DataNode identifier(s) (e.g. ‘P45985’). Datanodes can be (gene/protein/metabolite identifiers). For one node, you can use a string (or number) or list of one identifier. you can also provide a list of identifiers.

  • codes (str) – You can restrict the search to a specific database. See http://developers.pathvisio.org/wiki/DatabasesMapps#Supporteddatabasesystems for details. Examples are “L” for entrez gene, “En” for ensembl. See also the note here below for multiple identifiers/codes.

Returns

a dictionary

>>> s.findPathwaysByXref(ids="P45985")
>>> s.findPathwaysByXref(ids="P45985", codes="L")
>>> s.findPathwaysByXref(ids=["P45985"], codes=["L"])
>>> s.findPathwaysByXref(ids=["P45985", "ENSG00000130164"], codes=["L", "En"])

Note that in the last example, we specify multiple ids and codes parameters to query for multiple xrefs at once. In that case, the number of ids and codes parameters should match. Moreover, they will be paired to form xrefs, so P45985 is searched for in the “L” database while “ENSG00000130164” is searched for in the En” database only.

getColoredPathway(pathwayId, filetype='svg', revision=0, color=None, graphId=None)[source]

Get a colored image version of the pathway.

Parameters
  • pwId (str) – The pathway identifier.

  • revision (int) – The revision number of the pathway (use ‘0’ for most recent version).

  • fileType (str) – The image type (One of ‘svg’, ‘pdf’ or ‘png’). Not yet implemented. svg is returned for now.

Returns

Binary form of the image.

Todo

graphId, color parameters

getCurationTags(pathwayId)[source]

Get all curation tags for the given pathway.

Parameters

pathwayId (str) – the pathway identifier.

Returns

Array of WSCurationTag. The curation tags.

s.getCurationTags("WP4")
getCurationTagsByName(name)[source]

Get all curation tags for the given tag name.

Use this method if you want to find all pathways that are tagged with a specific curation tag.

Parameters

tagName (str) – The tag name.

Returns

Array of WSCurationTag. The curation tags (one instance for each pathway that has been tagged).

s.getCurationTagsByName("Curation:FeaturedPathway")
getOntologyTermsByPathway(pathwayId)[source]

Get a list of ontology terms for a given pathway.

Parameters

pathwayId (str) – the pathway identifier.

Returns

Array of WSOntologyTerm. The ontology terms.

s.getOntologyTermsByPathway("WP4")
getPathway(pathwayId, revision=0)[source]

Download a pathway from WikiPathways.

Parameters
  • pathwayId (str) – the pathway identifier.

  • revision (int) – the revision number of the pathway (use ‘0’ for most recent version).

Returns

The pathway as a dictionary. The pathway is stored in gpml format.

s.getPathway("WP2320")
getPathwayAs(pathwayId, filetype='png', revision=0)[source]

Download a pathway in the specified file format.

Parameters
  • pathwayId (str) – the pathway identifier.

  • filetype (str) – the file format (default is .owl).

  • revision (int) – the revision number of the pathway (use ‘0’ for most recent version - this is default).

Returns

The file contents

Changed in version 1.3.0: return raw output of the service without any parsing

Note

use savePathwayAs() to save into a file.

getPathwayHistory(pathwayId, date)[source]

Get the revision history of a pathway.

Parameters
  • pathwayId (str) – the pathway identifier.

  • date (str) – limit the results by date, only history items after the given date (timestamp format) will be included. Can be a string or number of the form YYYYMMDDHHMMSS.

Returns

The revision history.

Warning

seems unstable does not return the results systematically.

s.getPathwayHistory("WP4", 20110101000000)
getPathwayInfo(pathwayId)[source]

Get some general info about the pathway.

Parameters

pathwayId (str) – the pathway identifier.

Returns

The pathway info.

>>> from bioservices import *
>>> s = Wikipathway()
>>> s.getPathwayInfo("WP2320")
getPathwaysByOntologyTerm(terms)[source]

Get a list of pathways tagged with a given ontology term.

Parameters

terms (str) – the ontology term identifier.

Returns

dataframe with pathways infomation.

>>> from bioservices import WikiPathways
>>> s = Wikipathway()
>>> s.getPathwaysByOntologyTerm('PW:0000724')
getPathwaysByParentOntologyTerm(term)[source]

Get a list of pathways tagged with any ontology term that is the child of the given Ontology term.

Parameters

term (str) – the ontology term identifier.

Returns

List of WSPathwayInfo The pathway information.

getRecentChanges(timestamp)[source]

Get the recently changed pathways.

Parameters

timestamp (str) – Only get changes from after this time. Timestamp format: yyyymmddMMHHSS (string or number)

Returns

The changed pathways in XML format

s.getRecentChanges(20110101000000)

Todo

interpret XML

listOrganisms()[source]
listPathways(organism=None)[source]

Get a list of all available pathways.

Parameters

organism (str) – If provided, the data is filtered to keep only the organism provided, which must be a valid name (check out organism attribute)

Returns

dataframe. Index are the pathways identifiers (e.g. WP1)

(Source code, png, hires.png, pdf)

_images/references-4.png
login(usrname, password)[source]

Start a logged in session using an existing WikiPathways account.

Warning

Interface not exposed in bioservices.

This function will return an authentication code that can be used to excecute methods that need authentication (e.g. updatePathway).

Parameters
  • name (str) – The username of the WikiPathways account.

  • password (str) – The password of the WikiPathways account.

Returns

The authentication code for this session.

property organism

Read/write attribute for the organism

organisms

Get a list of all available organisms.

removeCurationTag(pathwayId, name)[source]

Remove a curation tag from a pathway.

Warning

Interface not exposed in bioservices.

saveCurationTag(pathwayId, name, revision)[source]

Apply a curation tag to a pathway. This operation will overwrite any existing tag with the same name.

Warning

Interface not exposed in bioservices.

Parameters

pathwayId (str) – the pathway identifier.

savePathwayAs(pathwayId, filename, revision=0, display=True)[source]

Save a pathway.

Parameters
  • pathwayId (str) – the pathway identifier.

  • filename (str) – the name of the file. If a filename extension is not provided the pathway will be saved as a pdf (default).

  • revisionNumb (int) – the revision number of the pathway (use ‘0 for most recent version).

  • display (bool) – if True the pathway will be displayed in your browser.

Note

Method from bioservices. Not a WikiPathways function

Changed in version 1.7: return PNG by default instead of PDF. PDF not working as of 20 Feb 2020 even on wikipathway website.

showPathwayInBrowser(pathwayId)[source]

Show a given Pathway into your favorite browser.

Parameters

pathwayId (str) – the pathway identifier.

updatePathway(pathwayId, describeChanges, gpmlCode, revision=0)[source]

Update a pathway on WikiPathways website with a given GPML code.

Warning

Interface not exposed in bioservices.

Note

To create/modify pathways via the web service, you need to have an account with web service write permissions. Please contact us to request write access for the web service.

Parameters
  • pwId (str) – The pathway identifier.

  • description (str) – A description of the modifications.

  • gpml (str) – The updated GPML code.

  • revision (int) – The revision number of the version this GPML code was based on. This is used to prevent edit conflicts in case another client edited the pathway after this client downloaded it.

  • WSAuth_auth (object) – The authentication info.

Returns

Boolean. True if the pathway was updated successfully.

Applications and extra tools

Web services have lots of overlap amongst themselves. For instance, fetching a FASTA sequence can be done using many different services. Yet, once a FASTA is retrieved, one may want to perform additional tasks or save the FASTA into a file or whatever repetitive functionalities not included in Web Services anymore.

The goal of this sub-package is to provide convenient tools, which are not web services per se but that makes use of one or several Web Services already available within BioServices.

Warning

this is experimental and was added in version 1.2.0 so it may change quite a lot.

Peptides
class Peptides(verbose=False)[source]
>>> p = Peptides()
>>> p.get_peptide_position("Q8IYB3", "VPKPEPIPEPKEPSPE")
189

Sometimes, peptides are provided with a pattern indicating the phospho site. e.g.,

>>>
get_fasta_sequence(uniprot_name)[source]
get_phosphosite_position(uniprot_name, peptide)[source]
FASTA
class FASTA[source]

Dedicated class to manipulates FASTA sequence(s)

Here is a FASTA file example:

>sp|P43408|KADA_METIG Adenylate kinase OS=Methanotorris igneus GN=adkA PE=1 SV=2
MKNKVVVVTGVPGVGGTTLTQKTIEKLKEEGIEYKMVNFGTVMFEVAKEEGLVEDRDQMR
KLDPDTQKRIQKLAGRKIAEMAKESNVIVDTHSTVKTPKGYLAGLPIWVLEELNPDIIVI
VETSSDEILMRRLGDATRNRDIELTSDIDEHQFMNRCAAMAYGVLTGATVKIIKNRDGLL
DKAVEELISVLK

The format is made of a header and a sequence. Any FASTA can be read and the pair of header/sequence retrieved from the sequence and header attributes. However, headers differ from one database to another one and interpretation is not implemented except for SWISS-PROT. Identifiers can be retrieved whatsoever.

You can read a FASTA sequence from a local file or download one from UniProt

>>> from bioservices.apps.fasta import FASTA
>>> f = FASTA()
>>> f.load("P43403")
>>> acc = f.accession    # the accession (P43403)
>>> fasta = f.fasta      # raw FASTA string
>>> seq = f.sequence     # the sequence itself
>>> header = f.header    # the header itself
>>> identifier = f.identifier

You can also get a dataframe also using Pandas library.:

>>> f.df

The columns stored in the dataframe encompase:

  • Accession that is taken from the header (e.g., P43403 from uniprot)

  • Sequence, a copy of the FASTA sequence

  • Size, the length of the sequence.

  • Database, the database type found in the header (e.g., sp for SWISS-PROT; see below for a list of database and their header format).

  • Some column such as Organism are filled only for some database

  • Identififers is the begining of the header.

See also

MultiFASTA for multi FASTA manipulation.

List of identifiers corresponding to different databases.

GenBank

gi|gi-number|gb|accession|locus

EMBL Data Library

gi|gi-number|emb|accession|locus

DDBJ, DNA Database of Japan

gi|gi-number|dbj|accession|locus

NBRF PIR

pir||entry

Protein Research Foundation

prf||name

SWISS-PROT

sp|accession|name

Brookhaven Protein Data Bank (1)

pdb|entry|chain

Brookhaven Protein Data Bank (2)

entry:chain|PDBID|CHAIN|SEQUENCE

Patents

pat|country|number

GenInfo Backbone Id

bbs|number

General database identifier

gnl|database|identifier

NCBI Reference Sequence

ref|accession|locus

Local Sequence identifier

lcl|identifier

The :meth::load_fasta relies on UniProt service.

property PE

returns PE keyword found in the header if any

property SV

returns SV keyword found in the header if any

property accession
property dbtype
property df
property entry

returns entry only

property fasta

returns FASTA content

property gene_name

returns gene name from GN keyword found in the header if any

get_fasta(id_)[source]

Fetches FASTA from uniprot and loads into attrbiute fasta

Parameters

id (str) – a given uniprot identifier

Returns

the FASTA contents

property header

returns header only

property identifier
known_dbtypes = ['sp', 'gi']
load(id_)[source]
load_fasta(id_)[source]

Fetches FASTA from uniprot and loads into attribute fasta

Parameters

id (str) – a given uniprot identifier

Returns

nothing

Note

same as get_fasta() but returns nothing

property name
property organism

returns organism from OS keyword found in the header if any

read_fasta(filename)[source]

Reads a FASTA file and loads it

Type:

>>> f = FASTA()
>>> f.read_fasta(filename)
>>> f.fasta
Returns

nothing

Warning

If more than one FASTA is contained in the file, an error is raised

save_fasta(filename)[source]

Save FASTA file into a filename

Parameters
  • data (str) – the FASTA contents

  • filename (str) – where to save it

property sequence

returns the sequence only

class MultiFASTA[source]

Class to manipulate several several FASTA items

Here, we load some FASTA using UniProt web service:

>>> from bioservices import MultiFASTA
>>> mf = MultiFASTA()
>>> mf.load_fasta("P43408")
>>> mf.load_fasta("P21318")

You can then get back to your accession entries as follows

>>> mf.ids
['P43408', 'P21318']

And the sequences in the same order can be accessed:

>>> len(mf)
2

Each FASTA is stored in fasta, which is a dictionary where each values is an instance of FASTA:

>>> print(mf._fasta["P43408"].fasta)
>sp|P43408|KADA_METIG Adenylate kinase OS=Methanotorris igneus GN=adkA PE=1 SV=2
MKNKVVVVTGVPGVGGTTLTQKTIEKLKEEGIEYKMVNFGTVMFEVAKEEGLVEDRDQMR
KLDPDTQKRIQKLAGRKIAEMAKESNVIVDTHSTVKTPKGYLAGLPIWVLEELNPDIIVI
VETSSDEILMRRLGDATRNRDIELTSDIDEHQFMNRCAAMAYGVLTGATVKIIKNRDGLL
DKAVEELISVLK

The most convenient way to access to all data is to use the dataframe attribute:

>>> mf.df.Sequence
>>> from bioservices.apps import MultiFASTA
>>> f = MultiFASTA()
>>> f.load_fasta(["P43403", "P43410"])
>>> f.df.Size.hist()

(Source code, png, hires.png, pdf)

_images/references-5.png
property df
property fasta

Returns all FASTA instances

hist_size(**kwds)
property ids

returns list of keys/accession identifiers

load_fasta(ids)[source]

Loads a single FASTA file into the dictionary

read_fasta(filename)[source]

Load several FASTA from a filename

save_fasta(filename)[source]

Save all FASTA into a file

References to BioServices on the Web

FAQS

General Errors

The most common errors come from

  1. The web service that you are trying to access is down (temporarily or not)

  2. The web service API has changed

  3. A request inside bioservices is incorrect

  4. A timeout occured.

For the first problem, we cannot do anything except wait for the service to be up again.

For the second, you are trying to update bioservices to reflect those changes.

For the two other issues, which are really bioservices problems, we recommend to rerun your code setting the logging level to debug and send the code and errors you see.

To set the debug level on on a web service:

u = UniProt(verbose=True)
u.logging.level = 'DEBUG'
Installation issues
ValueError: unknown locale: UTF-8 under Mac OS X 10.7 - Lion

The installation with PIP is succesful but I get a “ValueError: unknown locale: UTF-8” under Mac OS X 10.7 - Lion when typing from bioservices import *.

On solution is to fix your environment by typing the following code in a shell:

export LANG="it_IT.UTF-8"
export LC_COLLATE="it_IT.UTF-8"
export LC_CTYPE="it_IT.UTF-8"
export LC_MESSAGES="it_IT.UTF-8"
export LC_MONETARY="it_IT.UTF-8"
export LC_NUMERIC="it_IT.UTF-8"
export LC_TIME="it_IT.UTF-8"
export LC_ALL=

You can check if it works by typing

python -c 'import locale; print(locale.getdefaultlocale());'

If this works without error, then it is fixed and you should be able to import bioservices. If so, make this solution persistent by adding the code into your environment. For that, just copy and paste the code in a file called .bashrc_profile (or .bashrc)

reference

blog entry

General questions
How can I figure out the taxonomy identifier of the mouse ?

You can use the Taxon class that uses Ensembl/UniProt/Eutils depending on the tasks. Here, we do not know the scientific name of taxonomy identifier of the mouse. We can use the search_by_name fuction:

Warning

Taxon class is not part of BioServices but some utilities have been added to BioKit (github.com/biokit)

Changed in version 1.3.

In earlier version of BioServices, you could use:

>>> from bioservices import Taxon
>>> t = Taxon()
>>> t.search_by_name("mouse")
u'10090'

But this is now in BioKit:

>>> from biokit import Taxonomy
>>> t = Taxonomy()
>>> results = t.fetch_by_name('mouse')
>>> results[0]['id']
u'10090'
How to convert ID from one database to another ?

Many web services provides convertors. In BioServices, you can access to Kegg and UniProt that both provides convertor. For instance with Kegg, you can convert all human (hsa) Kegg Id to uniprot Id with:

from bioservices import *
s = KEGG()
kegg_ids, uniprot_ids = s.conv("hsa", "uniprot")

Or you can use the uniprot mapping function:

from bioservices import *
u = UniProt()
u.mapping(to="KEGG_ID", fr="ACC", query="ZAP70_HUMAN")
Specific Usage
Why my uniprot request takes forever ?

This may happen. Consider:

from bioservices import *
u = UniProt()
u.search("P53")

This request performed on UniProt web sites is actually pretty fast but there are 386 pages of results. In BioServices, the search commands reads the 386 pages of results and then stores the result in a variable. So it may take a while.

More generally if a request returns a very long result, it may take a while. You can use the socket module:

import socket
socket.setdefaulttimeout(5.)

After 5 seconds, the read() call will stop returning whatever has been read so far.

KEGG service
Is it possible to get the pathway information for multiple proteins ?

Currently there is no such function. You can only retrieve pathways given a single protein Id. However, you can easily write such a function. Here is the code for 2 proteins:

>>> p1 = k.get_pathway_by_gene("7535", "hsa")   # correspond to ZAP70
>>> p2 = k.get_pathway_by_gene("6885", "hsa")   # 6885 correspond to MAP3K7
>>> [k1 for k1 in p1.keys() if k1 in p2.keys()]
['hsa04660', 'hsa04064']

There are 2 pathways containing the proteins 7535 and 6885.

Interest of the BioServices classes REST and WSDL ?

There are a few technical aspects covered by BioServices to ease our life when adding new modules such as timeout, long request, headers, and so on.

What is the difference between GET and POST

When the user enters information in a form and clicks Submit , there are two ways the information can be sent from the browser to the server: in the URL, or within the body of the HTTP request.

The alternative to the GET method is the POST method. This method packages the name/value pairs inside the body of the HTTP request, which makes for a cleaner URL and imposes no size limitations on the forms output. It is also more secure.

Contributors

Contributors are the authors who started the development of BioServices (and authors of this reference on BioInformatics).

In addition to the main authors of the papers the following developers have implemented modules now available in BioServices:

  • Achilles Rasquinha implemented the BiGG models service bioservices.bigg module

  • Sven-Maurice Althoff, Christian Knauth implemented the bioservices.muscle module.

  • Patrick Short implemented the bioservices.clinvitae module

And thank you also to the contributions from users who have sent communication via emails or via the ticket system.

Special thanks to Thoba Lose (https://github.com/thobalose) and https://github.com/jsmusach for various pull requests.

Note that originally code (and earlier tickets) were hosted elsewhere.