#
# This file is part of bioservices software
#
# Copyright (c) 2013-2020 - EBI-EMBL - Institut Pasteur
#
# File author(s):
# Thomas Cokelaer <thomas.cokelaer@pasteur.fr>
#
# Distributed under the GPLv3 License.
# See accompanying file LICENSE.txt or copy at
# http://www.gnu.org/licenses/gpl-3.0.html
#
# website: https://github.com/cokelaer/bioservices
# documentation: http://packages.python.org/bioservices
#
##############################################################################
# $Id$
"""Interface to the PDB web Service (New API Jan 2021).
.. topic:: What is PDB ?
:URL: http://www.rcsb.org/pdb/
:REST: http://search.rcsb.org/#search-api
.. highlights::
An Information Portal to Biological Macromolecular Structures
-- PDB home page, Jan 2021
"""
from bioservices.services import REST
__all__ = ["PDB"]
[docs]class PDB:
"""Interface to `PDB <http://search.rcsb.org/>`_ service (new API Jan 2021)
With the new API, one method called :meth:`~bioservices.pdb.PDB.search` is
provided by PDB. To perform a search you need to define a query. Here is an
example
.. doctest::
>>> from bioservices import PDB
>>> s = PDB()
>>> query = {"query":
... {"type": "terminal",
... "service": "text",
... "parameters": {
... "value": "thymidine kinase"
... }
... },
... "return_type": "entry"}
>>> res = s.search(query)
.. note:: as of December 2020, a new API has been set up by PDB.
Some previous functionalities such as returning a list of Ligands are not
supported anymore (Jan 2021). However, many more powerful searches are
available. I encourage everyone to look at the PDB page for complex
examples: http://search.rcsb.org/#examples
As mentioned above, the PDB service provides one method called search available in
:meth:`~bioservices.pdb.PDB.search`. We will not cover all the power and
capability of this search function. User should refer to the official PDB help
for that. Yet, given examples from PDB should all work with this method.
When possible, we will add convenient aliases function in this class. For
now we have for example the :meth:`~bioservices.pdb.PDB.get_current_ids` and
:meth:`~bioservices.pdb.PDB.get_similarity_sequence` that users may find useful.
The main idea behind the PDB API is to create queries that can access to
different type of services. A query will need at least two keys:
- **query**
- **return_type**
Consider this basic example that searches for the text *thymidine kinase*::
{
"query": {
"type": "terminal",
"service": "text",
"parameters": {
"value": "thymidine kinase"
}
},
"return_type": "entry"
}
Here the query is defined by a **query** and a **return_type** indeed. The
return type is a simple value such as **entry**. The query itself is
composed of 3 pairs of key/value. Here we have the type service and
parameters as defined below.
The query can have several fields:
- **type**: the clause type can be either **terminal** or **group**
- **terminal**: performs an atomic search operation, e.g. searches
for a particular value in a particular field.
- **group**: wraps other terminal or group nodes and is
used to combine multiple queries in a logical fashion.
- **service**:
- **text**: linguistic searches against textual annotations.
- **sequence**: uses MMSeq2 to perform sequence matching searches (blast-like).
following targets that are available:
- pdb_protein_sequence,
- pdb_dna_sequence,
- pdb_na_sequence
- **seqmotif**: performs short motif searches against nucleotide or protein
sequences using 3 different inputs:
- simple (e.g., CXCXXL)
- prosite (e.g., C-X-C-X(2)-[LIVMYFWC])
- regex (e.g., CXCX{2}[LIVMYFWC])
- **structure**: searches matching a global 3D shape of assemblies
or chains of a given entry (identified by PDB ID), in either strict
(strict_shape_match) or relaxed (relaxed_shape_match) modes
- strucmotif: Performs structural motif searches on all available PDB structures.
- chemical: queries of small-molecule constituents of PDB structures,
based on chemical formula and chemical structure. Queries for matching and similar
chemical structures can be performed using SMILES and InChI descriptors
as search targets.
- graph-strict: atom type, formal charge, bond order, atom and bond chirality,
aromatic assignment are used as matching criteria for this search type.
- graph-relaxed: atom type, formal charge and bond order are used as
matching criteria for this search type.
- graph-relaxed-stereo: atom type, formal charge, bond order, atom
and bond chirality are used as matching criteria for this search
type.
- fingerprint-similarity: Tanimoto similarity is used as the matching criteria
Concerning the **return_type** key, it can be one of :
- entry: a list of PDB IDs.
- assembly: list of PDB IDs appended with assembly IDs in the format of
a [pdb_id]-[assembly_id], corresponding to biological assemblies.
- polymer_entity: list of PDB IDs appended with entity IDs in the format
of a [pdb_id]_[entity_id], corresponding to polymeric molecular entities.
- non_polymer_entity: list of PDB IDs appended with entity IDs in the
format of a [pdb_id]_[entity_id], corresponding to non-polymeric entities (or ligands).
- polymer_instance: list of PDB IDs appended with asym IDs in the format
of a [pdb_id].[asym_id], corresponding to instances of certain polymeric
molecular entities, also known as chains.
**Optional arguments**
There are many optional arguments. Let us see a couple of them. Pagination can be
set (default is 10 entries) using the **request_options** (optional) key.
Consider this query example::
{
"query": {
"type": "terminal",
"service": "text",
"parameters": {
"attribute": "rcsb_polymer_entity.formula_weight",
"operator": "greater",
"value": 500
}
},
"request_options": {
"pager": {
"start": 0,
"rows": 100
}
},
"return_type": "polymer_entity"
}
Here, the query searches for the polymer_entity that have a formula weight
above 500. With the request_options pager set to 100, we will get the first 100
hits.
To return all hits, set this field in the request_options::
"return_all_hits": true
Coming back at the first basic example, we can reuse it to illustrate how to
refine the search using attribute and operators::
{
"query": {
"type": "terminal",
"service": "text",
"parameters": {
"value": "thymidine kinase",
"attribute": "exptl.method",
"operator": "exact_match",
}
},
"return_type": "entry"
}
All valid combo of operators and attributes can be found
here: http://search.rcsb.org/search-attributes.html
For instance, in the example above only in, exact_match and exists can be
used with exptl.method attribute. This is not checked in bioservices.
Sorting is determined by the sort object in the request_options context.
It allows you to add one or more sorting conditions to control the order of
the search result hits. The sort operation is defined on a per field level, with
special field name for score to sort by score (the default).
By default sorting is done in descending order ("desc"). The sort can be
reversed by setting direction property to "asc". This example demonstrates how
to sort the search results by release date::
{
"query": {
"type": "terminal",
"service": "text",
"parameters": {
"attribute": "struct.title",
"operator": "contains_phrase",
"value": "\"hiv protease\""
}
},
"request_options": {
"sort": [
{
"sort_by": "rcsb_accession_info.initial_release_date",
"direction": "desc"
}
]
},
"return_type": "entry"
}
Again, many more complex examples can be found on PDB page.
"""
_url = "https://search.rcsb.org/rcsbsearch/v2/query"
def __init__(self, verbose=False, cache=False):
""".. rubric:: Constructor
:param bool verbose: prints informative messages (default is off)
:param bool cache: set to True to enable HTTP caching
"""
self.services = REST(name="PDB", verbose=verbose, cache=cache, url_defined_later=True)
self.services.url = PDB._url
[docs] def search(self, query, request_options=None, request_info=None, return_type=None):
"""search request represented as a JSON object.
This is the only function in PDB API. You should be able
to perform any valid PDB searches here (see the
:class:`bioservices.pdb.PDB` documentation for details.
Note, however, that we have aliases methods in BioServices that will be
added on demand for common searches.
:param dict query: the search expression. Can be omitted if, instead of IDs retrieval,
facets or count operation should be performed. In this case the request must be
configured via the request_options context.
:param dict request_options: (optional) controls various aspects of the search request
including pagination, sorting, scoring and faceting.
:param dict request_info: additional information about the query, e.g.
query_id. (optional)
:param str return_type: type of results to return (e.g. ``"entry"``, ``"polymer_entity"``).
:return: json results
You must define a query as defined in the PDB web page. For example the
following query search for macromolecular PDB entities that share 90% sequence
identity with GTPase HRas protein from Gallus gallus (Chicken)::
query = {
"query": {
"type": "terminal",
"service": "sequence",
"parameters": {
"evalue_cutoff": 1,
"identity_cutoff": 0.9,
"target": "pdb_protein_sequence",
"value": "MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLPARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMNCKCVIS"
}
},
"request_options": {
"scoring_strategy": "sequence"
},
"return_type": "polymer_entity"
}
What is important is that the dictionary called **query** contains 2
compulsory keys namely **query** and **return_type**. The two other optional
keys are **request_options** and **return_info**
You would then call the PDB search as follows::
from bioservices import PDB
p = PDB()
results = p.search(query)
Now, in BioServices, you can also decompose the query as follows::
query = {
"type": "terminal",
"service": "sequence",
"parameters": {
"evalue_cutoff": 1,
"identity_cutoff": 0.9,
"target": "pdb_protein_sequence",
"value": "MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLPARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMNCKCVIS"
}}
request_options = { "scoring_strategy": "sequence"}
return_type= "polymer_entity"
and then use PDB search again::
from bioservices import PDB
p = PDB()
results = p.search(query, request_options=request_options, return_type=return_type)
or even simpler for the Pythonic lovers::
results = p.search(**query)
"""
if "query" in query:
pass
else:
query = {"query": query}
if request_options:
query["request_options"] = request_options
if request_info:
query["request_info"] = request_info
if return_type:
query["return_type"] = return_type
if "return_type" not in query: # pragma: no cover
raise ValueError("Your query must have a return_type key")
print
res = self.services.http_post("", frmt="json", json=query)
return res
[docs] def get_current_ids(self):
"""Get a list of all current PDB IDs."""
# first query returns 10 entries by default
request_options = {"return_all_hits": True}
# second requests all entries
res = self.search(
query={"type": "terminal", "service": "text"},
request_options=request_options,
return_type="entry",
)
identifiers = [x["identifier"] for x in res["result_set"]]
return identifiers
[docs] def get_similarity_sequence(self, seq):
"""Search for sequence similarity with a protein sequence.
:param str seq: protein sequence in single-letter amino acid code
::
seq = "VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTAVAHVDDMPNAL"
results = p.get_similarity_sequence(seq)
"""
res = self.search(
{
"query": {
"type": "terminal",
"service": "sequence",
"parameters": {"target": "pdb_protein_sequence", "value": seq},
},
"return_type": "polymer_entity",
}
)
return res